KEGG   Gossypium hirsutum (upland cotton): 107919820Help
Entry
107919820         CDS       T04793                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi00020  Citrate cycle (TCA cycle)
ghi00620  Pyruvate metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Module
ghi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107919820
   00020 Citrate cycle (TCA cycle)
    107919820
   00620 Pyruvate metabolism
    107919820
Enzymes [BR:ghi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107919820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 107919820
NCBI-ProteinID: XP_016704683
UniProt: A0A1U8KUK3
LinkDB All DBs
Position
24
AA seq 538 aa AA seqDB search
MQTQLGNAAFPRLLRRSLSYIPSILYSLHSLLNLFHFFRFLSNSSPQSQKHKEMASPFLS
NTIISFSSSLSSSSSLPRLAPSIPFSAIRSKSTPRRILTVRSKIREIFMPALSSTMTEGK
IVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETALVGAAIGVLAE
TEDEIAEAKAKAASKSGASTPSAPPPAPAPGAASTPGPPKSTPAPAAPTVAEGPRKTVAT
PFAKKLAKQHKVDIESVVGTGPYGRITPEDIEAAAGLSPSKKNVGLAVVVETKHAAPAKA
PAASAAPSSLPPPVPGSTVVPFTTMQSAVSKNMVESLSVPTFRVGYPVTTDALDALYEKV
KPKGVTMTALLAKAAAMALAQHPLVNSSCKDGKSFTYNSNINIAVAVAINGGLITPVLQD
ADKLDLYLLSQKWKELVEKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIM
AVGASKPTVVADADGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESLTL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacagttgggtaatgcagcatttcctcgtcttctccgccgttccctctcttat
attccctccattctctactctctccattcgctccttaatttatttcatttctttcgcttt
ctctccaattcctctcctcaaagccaaaaacacaaggaaatggcttctccctttctctcc
aacactatcatctccttctcttcttccctttcttcttcttcttctcttcctcgtcttgcc
ccttcaattcctttctctgcaattcgttccaagtcaaccccaagacgaatcctgaccgtc
cgttccaagatcagggagatcttcatgcctgccctcagttctaccatgaccgagggcaag
atcgtctcttgggttaaatccgaaggtgatgtactctccaaaggtgaaagcgtcgtcgtt
gtcgaatccgacaaggctgacatggatgtcgagactttctatgacggcattctcgctgct
atagttgttggggaaggcgaaactgctcttgttggtgctgccattggtgttctcgctgag
actgaagatgaaattgctgaggctaaagccaaagctgcctcaaaatcaggtgcttcaacc
ccatctgctcctcctcctgctccagctccaggtgctgcctctactccaggtcctcccaaa
tcgacgccagctcccgcggctccaacagttgcggaggggccgaggaagactgttgccaca
ccatttgcaaagaagttagcgaagcagcacaaggtggacattgagtctgtggttggaaca
ggtccgtatgggaggattacgccagaggacattgaggccgccgccggtctttcgccttcg
aagaaaaatgtggggcttgcagtggttgtggaaacgaagcatgcagcaccagcgaaagct
ccagctgcttctgccgccccttctagccttcctcctccagttccaggatctacagtagtg
ccgtttacgacaatgcagtccgccgtttcgaaaaatatggtggagagcctttcagtgccc
acatttcgagtggggtatcctgtgactacggacgcgcttgatgccttgtatgagaaggtg
aaaccaaagggtgtgacaatgactgctttgttagccaaagctgccgcaatggcacttgcg
cagcaccctcttgtgaattcaagctgtaaagatggcaagagttttacttacaatagtaac
atcaacattgcagtagctgttgctattaatggtggcttgattacccctgttcttcaagat
gcagataagttggatttgtatctactgtctcaaaaatggaaagaattggtggagaaagcc
cgggcaaagcagcttcagcctcaagagtataattcggggacattcactctgtccaatctg
ggcatgtttggagtggacaggtttgatgccattcttcccccaggccagggagctatcatg
gctgttggagcatcaaagccaactgttgtagctgatgctgatggattcttcagcgtgaaa
aacaaaatgctggtgaatgttactgctgaccaccgaattatctatggtgctgatttggct
gccttccttcagaccttctcaaagattgttgagaaccctgaaagcctcactttgtag

DBGET integrated database retrieval system