KEGG   Gossypium hirsutum (upland cotton): 107920960Help
Entry
107920960         CDS       T04793                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00250  Alanine, aspartate and glutamate metabolism
ghi00410  beta-Alanine metabolism
ghi00430  Taurine and hypotaurine metabolism
ghi00650  Butanoate metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107920960
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107920960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107920960
   00430 Taurine and hypotaurine metabolism
    107920960
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107920960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 107920960
NCBI-ProteinID: XP_016706281
UniProt: A0A1U8KV35
LinkDB All DBs
Position
25
AA seq 498 aa AA seqDB search
MVLSKTASQSDVSVHSTFASRYVRDQLPRFRMPENSIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECNKLIMDAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPAKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNIMENCHENAMVLKEGLEK
TGRFNIVSKDEGVPLVAFSLKDNKRHDEFEISEMLRRFGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVIDIQKVLHELDTLPAKVNAKLAMAEEENSKNGTVKKTAIETQREIT
SYWKKFVSERKTNKNKIC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatccaagacagcttctcaatctgatgtctcagttcactccacttttgcctct
cgttatgtccgagaccaacttcctaggttcaggatgccagagaactcaataccaaaagac
gctgcatatcagatcatcaacgatgaactgatgcttgatgggaacccgaggttgaacctt
gcctcttttgtcactacctggatggagcctgaatgtaataagcttattatggatgccatt
aacaagaactatgtcgacatggatgagtaccctgtcaccaccgagcttcagaatcggtgt
gtgaacatgatagcacatttgttcaatgcaccacttggggactcggagactgccgttgga
gtgggaaccgttggttcatccgaggcaatcatgttggctggccttgccttcaagaggaag
tggcaaaacaagcgtaaagctgaaggcaaaccatatgacaagcccaacatcgtaaccgga
gccaatgttcaagtgtgctgggagaaattcgccaggtactttgaagtggagttgaaggaa
gtgaagctaagggaaggttactatgtaatggaccctgccaaagctgtggaaatggttgat
gaaaacaccatctgtgtagcagccatattgggttcaaccctcaatggtgaatttgaagac
gtcaagcttttaaacgatctcttggtagaaaagaacaaggaaactggatgggatacccca
attcatgttgatgcagctagtggtggattcattgcaccatttttgtacccagagcttgag
tgggactttaggcttccacttgtgaagagcatcaatgttagtggccacaaatatggtctt
gtttatgctggaattggttgggttatctggaggaacaaggaagacttgcctgaagaactt
attttccacattaactaccttggagctgatcaacccactttcactctcaatttctccaaa
ggttctagccaagtcattgctcagtattaccagctaattcgtttgggttatgagggatac
agaaatataatggagaactgtcatgaaaacgctatggtcctaaaagaagggttggagaaa
acaggtcgcttcaacattgtgtcaaaggacgaaggggttccactcgtggccttctctctc
aaggacaacaagcgccatgatgaattcgagatatccgaaatgctgcgccgatttggatgg
atcgtgccggcctacaccatgccggcggatgctcaacacatcacggtgctgcgtgtggtg
atcagggaagacttctcccgcaccttggcggagcgtcttgtgattgacatccaaaaggtg
cttcatgaactggatacactcccagcaaaggttaatgccaaactggctatggctgaggaa
gaaaatagcaaaaatggcacagtgaagaagactgccattgaaacccagagggaaataact
tcttactggaagaaatttgtgagcgagaggaagactaacaagaataaaatctgttag

DBGET integrated database retrieval system