KEGG   Gossypium hirsutum (upland cotton): 107926744Help
Entry
107926744         CDS       T04793                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00020  Citrate cycle (TCA cycle)
ghi00190  Oxidative phosphorylation
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107926744
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107926744
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107926744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl OPA3
Motif
Other DBs
NCBI-GeneID: 107926744
NCBI-ProteinID: XP_016713155
UniProt: A0A1U8LF02
LinkDB All DBs
Position
4
AA seq 630 aa AA seqDB search
MWRCVSRSLRVPYSNRSVAANSLRSNISSFFSTHAGSPYTIVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMNSNGSCQGVIALNMEDGTLHRFQASSTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIRGSDPDSVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGQKQKPLEKDAGERTIA
WLDKIRNSNGSLPTSNIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDR
SLIWNSDLIESIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGFWE
NEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtagccttcgagttccatattccaacagatcagttgccgct
aactctcttagatctaacatttccagtttcttctccactcatgctgggtccccttataca
atagtggatcatacgtatgatgcagttgtggttggtgctggtggtgcggggctgagagca
gccattggtctttcagagcatggatttaatactgcttgcataactaagcttttcccaact
cgttcacatactgttgcggctcagggtggcataaatgctgctttgggaaatatgactgaa
gatgactggcgatggcacatgtatgacacagttaaaggaagtgattggttaggtgatcag
gatgcaattcaatatatgtgcagggaggcaccaaaagccgtgattgaactcgagaattat
gggctgcctttttctcgaacagaagatgggaaaatatatcagagagcatttggtggtcaa
agccttgactttggaaaaggtggacaggcttatcgttgtgcatgtgctgctgatcgaaca
gggcatgctctactgcacactctctatggccaagctatgaaacataatacccaattcttt
gtggaatattttgctttggatctattgatgaacagcaatggaagctgccagggagtgata
gctttaaacatggaggacggaacactacatcgcttccaggcttcttcaacaattctggcc
actgggggatatggtagagcctacttttctgcaacttcagctcacacatgcactggtgat
ggcaatgctatggttgcacgtgctgggcttcccctccaggatttggagtttgtgcagttc
catccaactggaatctatggggctgggtgcctcattactgaagggtctcgtggtgaaggt
ggcatccttagaaatagtgaaggtgaacgctttatggaacggtatgctcctacagccaag
gatcttgcttcaagggatgttgtttcgagatctatgaccatggaaatcagggaaggtcgt
ggtgtaggacctttgaaggatcatatctatctccacttgaatcacttgcctccagaggtg
cttaaggagaggcttccaggtatctctgagactgctgccatttttgctggtgtggatgtt
acaaaggagcccatcccagtcttgcctactgtacattataacatgggtggaattccaaca
aatcatcatggagaggtagttactatcagaggcagtgatccagattctgtggttcctgga
ctgatggctgctggagaggcagcctgtgcatcagttcatggtgctaatcggttgggtgca
aattcccttcttgacattgtcgtctttggtcgggcttgtgcaaaccgagttgcagagatc
caaaggccagggcagaagcagaaacctttggaaaaggatgctggtgagagaacaattgca
tggttagacaaaataagaaattctaatggttctcttccaacttcaaacattcgattaaat
atgcaacgagtaatgcaaaacaatgctgctgttttccgcacacaggaaacactagaggaa
ggttgtcagttaattgataagacatgggaaagcttccatgatgttaagttgaaggatcgc
agtttaatatggaactctgatttgatagaatctatcgagttggaaaatcttttgataaat
gcctgtatcaccatgcactccgctgaagctaggaaagagagcagaggagcacatgctcgt
gaagattttacgaaaagagatgatgagaactggatgaaacacacattgggtttttgggag
aatgagaaggtgagactggattaccggccagttcacatgaacacattagatgatgaagtt
gagtcattcccacctaaagctcgtgtctattaa

DBGET integrated database retrieval system