KEGG   Gossypium hirsutum (upland cotton): 107927040Help
Entry
107927040         CDS       T04793                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00630  Glyoxylate and dicarboxylate metabolism
ghi00710  Carbon fixation in photosynthetic organisms
ghi01100  Metabolic pathways
ghi01200  Carbon metabolism
Module
ghi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ghi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ghi_M00532  Photorespiration
ghi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107927040
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107927040
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107927040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 107927040
NCBI-ProteinID: XP_016713500
UniProt: A0A1U8LG07
LinkDB All DBs
Position
Unknown
AA seq 167 aa AA seqDB search
MSAGIFASPIAGSGFVGLKTNVTKLVPTNGSISWSRKTVSNGSRTHCMKTWNPINNKKFE
TLSYLPPLSDDSIAKEIDYMMKKGWIPCLEFDEVGAVHRENSSIPGYYDGRYWTLWKLPM
FGCNDSSQVLKEIHECKKAYPNAYIRCLAFDNKHQAQCMSFVIHKPN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccggaatctttgcatcaccaatcgctggttctggttttgttggcctgaaaacc
aatgttacaaagctggttccaactaatggttctatttcatggagccggaaaactgtgtcc
aatggttcaagaacccactgcatgaagacatggaatccaatcaacaacaagaagtttgag
acgctttcttaccttccacctctctcagatgactcgattgcaaaggaaattgattacatg
atgaaaaaagggtggattccttgtcttgaatttgatgaggtgggggctgtccacagggag
aatagcagcattccagggtactatgatgggaggtattggactctatggaagctgccgatg
tttgggtgcaacgactcttctcaagtcctgaaagaaattcacgagtgcaaaaaggcatac
cccaatgcttatatccgttgcctggcatttgacaacaagcaccaagctcagtgcatgtcc
tttgtcattcacaaacctaactga

DBGET integrated database retrieval system