KEGG   Gossypium hirsutum (upland cotton): 107927137Help
Entry
107927137         CDS       T04793                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi03030  DNA replication
ghi03410  Base excision repair
ghi03420  Nucleotide excision repair
ghi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107927137
   03410 Base excision repair
    107927137
   03420 Nucleotide excision repair
    107927137
   03430 Mismatch repair
    107927137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ghi03032]
    107927137
   03400 DNA repair and recombination proteins [BR:ghi03400]
    107927137
Enzymes [BR:ghi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107927137
    6.5.1.6  DNA ligase (ATP or NAD+)
     107927137
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107927137
DNA replication proteins [BR:ghi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107927137
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107927137
DNA repair and recombination proteins [BR:ghi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107927137
   NER (nucleotide excision repair)
    Other NER factors
     107927137
   MMR (mismatch excision repair)
    Other MMR factors
     107927137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 107927137
NCBI-ProteinID: XP_016713631
UniProt: A0A1U8LG77
LinkDB All DBs
Position
Unknown
AA seq 796 aa AA seqDB search
MLTFRPSHLFRCTFCITRPLTPLLPPSSSHFLPSNSPFFRPKPLSLSSLNPHSNMSTHPS
AFDALMSNARRLAGKKSSSSSSPTKKRKSLDSSPTENPKTVGSTEVKHDPEVSTDGIGKP
INDSAKPNLYEAKKPPDSKKVKVGSASERNVEMKGKIRLLKKKPADFDPNMVACWEKGER
VPFLFLSLAFDLISNETGRIVITDIVCNMLRTVIATTPDDLVATVYLAANKVAPAHEGLE
LGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIKVFD
TFRLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQAKLRIGFSEQTLLAALGQA
AVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFTPGV
PVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNTGKF
PDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILITRARKNVVVSEIKVDVCIF
AFDILYLNGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQTFLNSAVSSS
CEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGAF
LLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVWFET
TEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAEMYN
AQKHNQTNNEDDGEDD
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgtttcgcccatcccatcttttccgctgtactttttgtattactcgtcctctc
acccctctccttcctccctcttcctcccatttccttccttccaactcgcctttctttcgc
cccaaacccctctctctttcttccttaaaccctcactccaacatgtccactcacccctcc
gccttcgatgctttaatgtctaatgctcgccgtttagccggtaagaagagctcttcctct
tcttcgcccaccaagaaacgcaaatccctcgattcgtcgcccaccgaaaaccctaaaacc
gtcggctccactgaagtcaagcacgacccagaggtttctactgatggaatcggaaagccc
attaacgattccgcaaaacccaatttatatgaggcgaagaaacccccggattcgaagaag
gtgaaggtggggagcgcctccgagagaaacgtggagatgaaagggaaaattcggttgttg
aagaagaagccggcggattttgatcccaatatggtggcgtgttgggagaaaggagagagg
gtgccgtttttgtttctgagcctggcgtttgatttgatatccaatgagacgggtcggatt
gtgataacggatattgtttgcaatatgttgaggactgttattgctaccacgccggatgat
ttggtggcgacggtttacttggcagcaaataaggttgctccggcgcatgaggggttagag
ctgggaatcggtgatgcatccattatcaaggccctagctgaggcctgtgggaggactgaa
tcacaggttaagagtcagtacaaggataaaggagacctgggccttgttgctcaggctagc
cgttcatctcaatcaatgatgcgcaagcctgatccattgactgttatcaaagtgtttgac
acgtttcggctaattgctaaggaatctggaaaggatagtcaggagaagaaaaagaatcgt
atcaaatcacttcttgttgctgcaactgactgtgaacctcagtatttgattcgtctgctt
caggcaaagctgcggattggattttcagagcagactctgttagctgcattaggacaggct
gctgtatataatgaacaacattctaaaccacctccaaatgttcagtctcctttagaggag
gctgctaagattgtcaaacaagttttttctatccttccagtctatgataaaatagtccca
gcactcttgactggtggtgtatgggatctgcctaagagttgtggctttacaccgggtgtt
cctgttggacctatgctagcaaaaccaaccaaaggtgttgctgaaatcataaataaattc
caggacattgacttcatatgtgaatataagtatgatggagagcgtgcgcagatacactat
atggagaatggttcagttgagatatacagtcgaaatgctgagtgtaacactggaaagttt
cctgatgttgttgctgcaatttctagatttaagaagtcctctgtaaaatcatttgttttg
gattgtgagcttgttgcttatgatcgtgttcaaaagaaaatattaccctttcagatcctt
attacaagagcacggaaaaatgtggtagtgagtgaaattaaagttgatgtgtgcatattc
gcttttgacatcttataccttaacgggcaaccacttcttcatgagcaacttaaagttcgt
aaggagaggctttatgattcatttgaggaagaacctgggttttttcaatttgcaacagcc
ttaacatcaaatgatcttgaggagattcaaacattccttaattctgctgtttcttcaagt
tgtgagggtttaattatcaaaacattggatagagatgctacatatgagccatcgaagcgg
tcactcaactggctaaaattgaagaaagactacatggaaagtattggcgacacattagat
ctagtacctattgctgctttccatggccgtgggaaacgaactggcttctatggtgctttt
ctcttggcatgttatgatgaaaataatgaagaattccagagtatctgtaaaataggtact
ggattttctgaagcagagcttgaggaacgttctgccagtctccgctctaaagtgattcct
gaaccaaagtcgtactatcgttgttctgagatgatgaagccagatgtatggtttgagact
acagaggtttgggaggtaaaagctgcagacttgaccattagccctgttcatcgtgctgct
attgggattgtggatcctgataagggcatatctctccgatttccacgtttagttcgtgtt
cgagaagataagacaccagagcaagcttcatcatctgagcaggttgctgagatgtataat
gctcaaaaacacaatcaaaccaataacgaagacgatggtgaggatgattga

DBGET integrated database retrieval system