KEGG   Gossypium hirsutum (upland cotton): 107938100Help
Entry
107938100         CDS       T04793                                 

Definition
(RefSeq) hexokinase-2, chloroplastic-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi00051  Fructose and mannose metabolism
ghi00052  Galactose metabolism
ghi00500  Starch and sucrose metabolism
ghi00520  Amino sugar and nucleotide sugar metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Module
ghi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ghi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107938100
   00051 Fructose and mannose metabolism
    107938100
   00052 Galactose metabolism
    107938100
   00500 Starch and sucrose metabolism
    107938100
   00520 Amino sugar and nucleotide sugar metabolism
    107938100
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107938100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ghi04131]
    107938100
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107938100
Membrane trafficking [BR:ghi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107938100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107938100
NCBI-ProteinID: XP_016726656
UniProt: A0A1U8MII2
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MSVTAIATATSSAIGSFRTRRSTNGVSRFKMSIRSSFVSMAAAPMLTKLQQDCATPLPVL
RNVASSMSDDIRAGLAVDGGSDLKMILSYVDSLPTGDEKGLFYALDLGGTNFRVLRVELG
GKDKRVIAIESDQVSIPQELMSATSEELFDFIASALANFANKGGNFPGKKGEIGFTFSFP
VKQTSIDSGILIKWTKGFAVSGTAGKDVVACLNEAMDRKGIDMRVSALVNDTVATLAGAR
YWDDDVMVAVILGTGTNACYVERMDCIPKLQGEFSPSGRTIVNLEWGAFSKGLPLTVFDR
DMDAASINPGEQIFEKTISGMYLGEIARRALLHMAEEGSLFGKSVPEKLSMPFVLGTPDL
STMQQDGTEDLHTVGSVLYNVAGVESDLSSRKIVLEVCDTIVKRAARLAGAGIVGILQKI
EEDTEDAIFGKRTVVAMDGGLYERYPQYRRYLKEAVAELLGPETSQNIVIEHSKDGSGIG
AALLAATNSKYGRNL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcactgcaatagcaactgcaacatcgtcagccattggatcgttccgtaccagg
cgatccacgaacggggtatctcggttcaagatgtccatccgatctagcttcgtttcaatg
gctgcggctcccatgttaaccaagctacagcaagactgcgccactcctttgccggttctt
cgcaacgtggcctcctccatgtctgatgatatccgtgcaggccttgccgttgatggcggc
agcgatctcaagatgatcctcagctacgtcgatagtttgcctactggggatgaaaaagga
ttgttttacgcactggatctgggaggaacaaattttcgtgttttgagggttgaattaggt
gggaaagataagcgtgtgatcgccattgaatccgaccaagtttcaatcccacaagaactc
atgtctgctacatctgaggagctgtttgattttattgcttcagctttggcaaattttgct
aataaaggtggaaactttcctggaaaaaaaggtgaaattgggttcactttttcattccca
gtgaagcaaacatccattgattctggaatattgattaagtggaccaaaggttttgctgtc
tctggaacggctggaaaagatgttgttgcttgtctgaatgaagctatggatcggaaaggg
atagatatgagagtgtctgccttggtgaatgatacggtagctactttggccggagctcga
tattgggatgatgatgttatggttgctgttattttgggtactggaacgaatgcttgctat
gtggaacggatggattgcattcctaaattgcaaggcgagttttccccttccggaagaaca
attgtgaaccttgagtggggagcattctcaaaaggccttcctttaacagtgttcgataga
gatatggatgctgctagtatcaatcccggagagcagatatttgagaagacaatctctgga
atgtaccttggtgaaattgcacgaagagctctgctgcatatggctgaagaaggttctctg
tttgggaaatccgtgccagaaaaactgtctatgccttttgtactcggaaccccggattta
tctacaatgcagcaagacggcacagaagatctgcacaccgttggatcagtcctatacaac
gtagccggggtcgagtccgacctaagttcaaggaagattgtcctagaggtatgcgacaca
atcgtgaagcgagctgcacgattagccggcgcagggatagtggggattcttcaaaagata
gaggaagatacagaagatgccatcttcggaaaacgaacggtagtggcaatggacggaggc
ttgtatgagcggtaccctcagtatagaaggtacttaaaagaggccgtagccgagcttctt
ggaccggaaacatcccaaaacattgtgatagagcactccaaggacggatcagggattggg
gctgctctcttggccgctacaaactccaagtatggtcgaaatctttag

DBGET integrated database retrieval system