KEGG   Gossypium hirsutum (upland cotton): 107941166Help
Entry
107941166         CDS       T04793                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00052  Galactose metabolism
ghi00500  Starch and sucrose metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107941166
   00500 Starch and sucrose metabolism
    107941166
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107941166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107941166
NCBI-ProteinID: XP_016730196
UniProt: A0A1U8MTL6
LinkDB All DBs
Position
Unknown
AA seq 907 aa AA seqDB search
MNTTQKKDLLHHLLLFFIIFSATSSSYLAVVHGVNEAVGYGYKLKSVSVDPEQKWLTADL
ALIRNSSVYGPDIQKLNLFVSFETSDRLRIRVTDSGHQRWEIPQEIIPRQSQNPFSLGSP
ANYPTRKLKETRSVSDPKSDLIFTLQNTTPFGFTVKRRSSGDTLFDASPDPSDPRTFLEF
KEQYIQLSSALPENRSSLYGLGEHTKRSFKLQHDDTLTLWNSDLASANLDFNLYGSHPFY
IDVRSASGNGRIAAGTSHGVLLFNSNGMDIVYGANRITYKVIGGIIDLYVFGGPLPHTVV
QQYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLEGVVAGYAKANIPLEVMWTDIDYMDGF
KDFTLDPVNFPEDKMKQLVDELHRNGQKYVVIIDPGISVNSSYGSYIRGMQADIFIKRDG
IPYLGEVWPGRVYFPDFVNPQTQTYWDGEIKLFRDILPVDGLWLDMNEVSNFITSPPTPN
SALDDPPYKINNQGIQRPINNKTVPATALHFGNLTEYNVHNLYGLLECKATHAALTNLTG
KRPFILSRSTFVSSGKYTAHWTGDNAATWEDLAYTIPSILNFGLFGIPMVGADICGFSGN
TTEELCRRWIQLGAFYPFARDHSELHSIRQELYIWDSVAATARKVLGLRYRLLPYFYTLM
YEAHTKGTPIARPLFFTFPQDVHTYEINSQFLVGKGIMVSPALHPGVVSVNAYFPNGNWF
DLFNYSNSVSATSGKYLTLAAPPDHINLHVREGNIIAMQGEAMTTKAARETPFQLLVAVS
NTENITGELFLDDGEAVEMGEGGGKWSFVRFHGADSGDSVSVRSEVENGEYALSKKWMIN
KVTFVGLEKRRRVKGYELSPGNTRILNGKPILKPKLGKDAQFQVVEITRLMLPVGEEFNL
QLKTPQT
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaacgcaaaaaaaggacttgctacatcatcttttattgttttttattatcttt
tctgctacttcttcttcttacttggccgttgttcatggggttaatgaagcagttggttat
ggctacaaactgaaatctgtttccgttgacccggagcaaaaatggttgaccgccgatctt
gctcttatccgcaactcctctgtttatggacctgatattcaaaaactcaatcttttcgtc
agcttcgagacaagcgatcgtttgagaatcagagttacagattcagggcatcaaagatgg
gaaatcccacaagaaattattcctcgtcaatcccaaaatcctttcagcctcggctcacca
gcaaactacccgacacggaagctaaaagaaacacgctcggtgtcggacccaaaatcggac
ctcattttcactctccaaaacaccactccattcgggttcacggtgaaacgccgctcctcc
ggcgacacccttttcgacgcatcaccggacccatcggacccacgcactttcttggagttc
aaggaacaatacatccaactctcctcggcgctgcctgaaaacaggtcgtctctgtacgga
ctcggggaacacacgaagagatcgttcaagttacaacacgacgacacgttgacgttatgg
aattccgatttagcgagtgctaatcttgacttcaatctttatggatcgcatcccttttac
attgatgtaagatcagcatctggtaatggcagaattgcggcaggaactagccatggagta
ttgttgtttaatagcaacggaatggacatagtctatggagcaaaccggataacttacaag
gtcattggaggaattatagacttgtatgtttttggaggaccattgccccacacagtcgtt
cagcagtatactgaacttattggccgccctgctcctatgccttattggtccttcggattc
catcagtgccgatatggttacaaaaacgtttctgacctcgagggtgtggttgctggctac
gccaaagctaacatccctctggaagttatgtggacggacatcgattacatggatggattt
aaggacttcactcttgaccccgtcaacttcccggaggacaagatgaaacaactcgtcgat
gagcttcatcggaatggtcaaaaatatgtggtcatcatagatcccggtatcagtgtaaac
agttcatatggaagctacatcagagggatgcaagctgatatattcataaaaagagatggc
atcccttatttgggtgaagtttggcctggtcgagtctactttccagattttgtaaaccct
caaacacaaacatattgggatggtgagatcaagttgtttcgagacattctccctgttgat
ggtctttggctcgacatgaatgaggtatccaacttcataacatcccctccaacgccaaat
tcagccttggatgatcctccttacaagatcaacaaccagggaattcaacgacccattaat
aacaaaacagttcctgcaactgctctgcattttggtaacctgacagaatacaatgttcat
aacctgtatggtttactggaatgtaaagcaactcatgcggcattgaccaatctgaccggc
aaacgcccatttatacttagcagatcaacgtttgtaagctctgggaaatatacagcacac
tggactggtgacaatgcagccacctgggaggatttggcttacacaattccatccattttg
aacttcggactctttggaattccaatggttggcgctgatatatgcggcttttccgggaat
accactgaagagctgtgcaggcgatggattcaactaggggcattttaccctttcgctaga
gatcactcggagcttcattcaatccggcaagagctctatatctgggattcagtggctgcc
acagctaggaaagtgctgggcctccggtaccgcctgttgccatacttttacaccctaatg
tacgaggcacacacgaaagggactcccattgcaaggcccctgttcttcacattccctcaa
gatgttcacacttacgaaatcaattcacagtttctggtaggtaaaggtataatggtttca
cctgcattacacccgggagtagtttcagtcaatgcttatttcccgaacggaaactggttc
gacctcttcaattactccaactcagtgagcgcaacatccgggaaatacttaacactcgct
gcaccccctgatcatataaaccttcatgtccgagaaggcaacatcatagccatgcaagga
gaggcaatgacgacgaaagccgctcgggaaacaccgttccaactcctggtggccgtcagc
aacactgagaacatcaccggggaactattcttggacgacggagaggcagtagagatggga
gaaggtgggggaaagtggagttttgtgagatttcatggagcagattccggtgatagcgta
tctgttagatctgaggttgagaatggagagtatgctttgagtaaaaaatggatgataaat
aaagtgacattcgtggggttggaaaaaaggaggagggtgaaggggtatgagttaagccct
ggaaacacaagaattttgaatggaaagccaattttgaagccgaaattaggcaaggatgcc
caattccaggttgtggagataacaagactgatgctacctgtcggagaggagttcaatttg
caactcaaaactccccaaacttag

DBGET integrated database retrieval system