KEGG   Gossypium hirsutum (upland cotton): 107942506Help
Entry
107942506         CDS       T04793                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00564  Glycerophospholipid metabolism
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107942506
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107942506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox GIDA Lycopene_cycl NAD_binding_8 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 107942506
NCBI-ProteinID: XP_016731668
UniProt: A0A1U8N1J8
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MSATATSLRRIAAVATAAVAVTACSGAVLLPPSVSSNDRGVGPDVESMRRTISDPNAIVP
SRSVQESTLIGASSTSPLDILVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRST
KLIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFNWFEVVY
YWMGLKMYDLVAGRHILHLSRYYSVQESIELFPTLARKGKDKSLRGTVVYYDGQMNDSRL
TVGLACSAALAGAAVLNHAEVVSFLKDEGSERIIGAKIRDNLSGQEFETYAEVVVNAAGP
FCDSVRKMANKDAQPMICPSSGVHVVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVA
GTTDSNTSITALPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLAMDPTAKNTE
SISRDHVVCEDFPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLSPRNECITGNLRLVGGD
GWESSSFTVLAQQYVRMKKTHGGKVVPGVMDTASAKHLSHAYGTLAERVATIAQNETLGK
RLAHGYPYLEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAAGRALPRIIEILAKEHNW
DRSRQKQEMQKAREFLETFKSSKNAQFHDGKHK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaaccgccactagcctccgccggatcgccgccgttgctacagcggcagtagct
gttactgcctgcagtggtgctgttctcttacctccgtctgtttcttccaatgaccgcggc
gttggccccgacgtagagtccatgaggcggacgatcagtgatccaaacgccattgttcct
tccagaagtgtccaggaatcgactctgatcggtgccagctcgactagtccactcgacatc
ctggtcgtaggcggcggtgccaccggctgcggcgttgctttggacgctgccactagaggc
ctccgtgtcggccttgttgagcgagaggatttctcttccggaacgtcttctcggtctacg
aagctaattcatggaggggtccgatacttggagaaagctgtctttaaccttgactacggg
caattgaagctggttttccatgcacttgaggagcgtaaacaggttattgagaatgcgcct
catctctgccatgccttgccatgcatgacaccttgttttaactggtttgaggtagtatac
tactggatgggcttgaaaatgtacgatttggtcgcaggacgccatatattacatttgtcc
agatattattcagtgcaagaatctattgagctcttccctactcttgcaagaaagggtaaa
gataaaagcttgaggggcacagttgtgtactatgatgggcagatgaatgactctcgccta
actgttggattagcttgcagtgctgcacttgctggagcagcagtgcttaatcatgcagaa
gttgtatcatttcttaaagatgaaggttccgagaggataattggtgcaaaaattcgtgac
aatttgtcaggccaagaattcgaaacctatgcagaagttgttgtgaatgcggctggacca
ttttgtgactctgtaaggaaaatggctaacaaggatgcacagcccatgatttgtcctagc
agcggtgtacatgttgttctccctgattattattctcctgaaggaatgggtttgattgtc
cctaaaactaaggatggacgtgttgttttcatgcttccatggttggggagaactgtagct
ggcactacagattctaatacttccatcactgcacttccagaaccacatgaggatgaaata
caatttatacttgatgctatatgtgattatcttaacgtcaaggtacgacgcacagatgtt
ctttctgcttggagtggtattcgtccattggcaatggatcctactgcaaagaacactgag
agcatctctcgagatcatgttgtttgtgaggattttcctggtttggtcacaataactggt
ggaaagtggactacttatcgaagcatggcagaagatgcggtgaatgcagctatcaagtcc
ggtaagctaagccctaggaatgaatgtataacaggcaacctacggctggtcggtggagat
ggatgggaaagctcatcttttactgttcttgctcagcagtacgtacgcatgaagaagaca
catggtgggaaagttgttccaggagtaatggacacagctagcgcaaagcatttgtctcat
gcttatgggaccttagcggaacgagtagccacaatagctcagaatgaaacactgggtaag
aggcttgcccatggttacccatatctggaggccgaggttgcatactgtgctcgaaatgag
tactgtgaatctgctattgatttcattgccaggagatctcgccttgctttccttgacacc
gatgcggcaggccgagcattgccacgaattatcgaaatacttgctaaggagcacaattgg
gaccggtccaggcagaagcaagaaatgcagaaggctagagaatttttggaaactttcaag
tcttcgaagaatgcacagttccatgacgggaaacacaagtag

DBGET integrated database retrieval system