KEGG   Gossypium hirsutum (upland cotton): 107942584Help
Entry
107942584         CDS       T04793                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00020  Citrate cycle (TCA cycle)
ghi00190  Oxidative phosphorylation
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107942584
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107942584
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107942584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 Thi4 GIDA DAO Endonuclease_1 HI0933_like
Motif
Other DBs
NCBI-GeneID: 107942584
NCBI-ProteinID: XP_016731772
UniProt: A0A1U8MY55
LinkDB All DBs
Position
5
AA seq 915 aa AA seqDB search
MYVDDVDFGAIYKSCENKAVDKYFRFDGFLFCESKLCVPQSSIRKLLGGCTTSWSSENHC
IRSRHKVPKSFLENSMRKVRNEATVFNNKSSSNGWKNRGCESDLLPLPNDQLVHTDAKRK
ADYVKQLYQKVRTNIEARTEQYMRAANKGRKQIVFEPGDWVWVHMRKERFPAQRRSKLLS
RGDGPFQVLEQINENSYKLDLPGDYNISASFNVADLSPFDAGSDLGTNRLEEGGNDAIET
HELSSVNDISLERPKGPITRARANKLKNAISTLVDRVWSESVAVLLEKSWASKLSNPCNL
LQKKKLNQKYFGDGHLRSLQGPPYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACIT
KLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVI
ELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKH
NTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQASSTILATGGYGRTYFSATSAH
TCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERY
APTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIF
AGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIRGSDPDSVVPGLMAAGEAACASVHGA
NRLGANSLLDIVVFGRACANRVAEIQRPGQKQKPLEKDAGERTIAWLDKIRNSNGSLPTS
NIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDRSLIWNSDLIESIELE
NLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNT
LDDEVESFPPKARVY
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttgacgatgttgattttggtgctatttataaatcctgtgaaaacaaagccgtt
gataagtatttcaggtttgatggtttccttttctgtgaaagtaagctttgtgtgccgcaa
agttcaataaggaaattgttgggaggttgtacgacttcatggagttccgaaaaccattgt
atccgatcgagacacaaagttcctaagtcatttttggagaactctatgaggaaggttagg
aacgaagctactgttttcaacaataagtcatcctcaaacggatggaaaaacagaggttgt
gaatcggatttgcttcctttgcccaatgatcagcttgttcataccgatgcaaagcgaaaa
gccgattatgtgaagcaactttaccaaaaggtgagaaccaacattgaagctcgaaccgaa
caatatatgcgagctgccaataaaggaaggaagcaaatagtgttcgaacccggagattgg
gtttgggttcacatgaggaaggaaaggttcccagcccaacgaaggtcaaagctgttgtcg
agaggagacggtccctttcaagtgttggaacaaattaatgagaactcttacaagcttgat
cttccaggtgattacaatattagtgcaagctttaacgtggctgatttatctccctttgat
gcaggtagcgatttggggacaaaccgcctcgaagagggagggaatgatgcaatcgagacc
catgagctatcgagtgttaatgatatttcccttgagcgaccaaaaggacccattactcga
gctagagctaataagttaaagaatgcaatttcaactttggtggatcgagtttggagtgaa
tccgtggctgttctacttgaaaaatcatgggccagcaaattaagcaatccatgcaatcta
cttcaaaaaaaaaaactgaaccagaagtattttggtgatggacatttgcgatcattgcag
gggcccccttatacaatagtggatcatacgtatgatgcagttgtggttggtgctggtggt
gcggggctgagagcagccattggtctttcagagcatggatttaatactgcttgcataact
aagcttttcccaactcgttcacatactgttgcggctcagggtggcataaatgctgctttg
ggaaatatgactgaagatgactggcgatggcacatgtatgacacagttaaaggaagtgat
tggttaggtgatcaggatgcaattcaatatatgtgcagggaggcaccaaaagctgtgatt
gaactcgagaattatgggctgcctttttctcgaacagaagatgggaaaatatatcagagg
gcatttggtggtcaaagcctagactttggaaaaggtggacaggcttatcgttgtgcatgt
gctgctgatcgaacggggcatgctctactgcacactctctatggccaagctatgaaacat
aatacccaattctttgtggaatattttgctctggatctattgatgaacagtgatggaagc
tgccagggagtgatagctttaaacatggaggacggaacactacatcgcttccaggcttct
tcaacaattctggccacagggggatatggtagaacctacttttctgcaacttcagctcac
acatgcactggtgatggcaatgctatggttgcacgtgctgggcttcccctccaggatttg
gagtttgtgcagttccatccaactggaatctatggggctgggtgcctcattactgaaggg
tctcgtggtgaaggtggcatccttagaaatagtgaaggtgaacgcttcatggaacgatat
gctcctacagccaaggatcttgcttcaagggatgttgtttcgagatctatgaccatggaa
atcagggaaggtcgtggtgtaggacctttgaaggatcatatctatctccacttgaatcac
ttgcctccagaggtgcttaaggagaggcttccaggtatctctgagactgctgccattttt
gctggtgtggatgttacgaaggagcccatcccagtcttgcctactgtacattataacatg
ggtggaattccaacaaatcatcatggagaggtagttactatcagaggcagtgatccagat
tctgtggttcctggactgatggctgctggagaggcagcctgtgcatcagttcatggtgct
aatcggttgggtgcaaattcccttcttgacattgtcgtctttggtcgggcttgtgcaaac
cgagttgcagagatccaaaggccagggcagaagcagaaacctttggaaaaggatgctggt
gagagaacaattgcatggttggacaaaataagaaattctaatggttctcttccaacttca
aacattcgattaaatatgcaacgagtaatgcaaaataatgctgctgttttccgcacacag
gaaacactagaggaaggttgtcagttaattgataagacatgggaaagcttccatgatgtt
aagttgaaggatcgcagtttaatatggaactctgatttgatagaatctatcgagttggaa
aatcttttgataaatgcctgtatcaccatgcactctgctgaagctaggaaagagagcaga
ggagcacatgctcgtgaagattttacgaaaagagatgatgagaactggatgaaacacaca
ttgggttattgggagaatgagaaagtgagactggattatcggccagttcacatgaacaca
ttagatgatgaagtcgagtcattcccacctaaagctcgtgtctattaa

DBGET integrated database retrieval system