KEGG   Gossypium hirsutum (upland cotton): 107944444
Entry
107944444         CDS       T04793                                 

Definition
(RefSeq) cytochrome P450 CYP749A22-like
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00071  Fatty acid degradation
ghi00590  Arachidonic acid metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107944444
   00590 Arachidonic acid metabolism
    107944444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ghi00199]
    107944444
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     107944444
Cytochrome P450 [BR:ghi00199]
 Cytochrome P450, animal type
  CYP4 family
   107944444
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107944444
NCBI-ProteinID: XP_016733761
UniProt: A0A1U8N3U8
LinkDB
Position
Unknown
AA seq 349 aa
MTPAVIASVETMLDKWQEKEGEEIEAFQGFRLLTSEVISRTAFGSSYLEGEKIFYMLQKL
ADIVSRNTNKSRIPILSKFWKTDDDIESEKLAREIQDLVIEIVKKRENKVASGGAESFGC
DFLGLLVKAFNNPDEKNKISMEDLVDECKTFYFAGQETVNASLAWAVLVLAIHRDWQDKA
RREVMEIFGSQYPHFEGLAKLKIMSMIINETLRLYTPLNGLLRRATRQVQVGKLVLPAKV
EVLIPNMALHHDPQLWGDDAHVFKPERFEEGIAKATRYNAAAFIPFGMGPRACVGMTFAI
NETKTALSMILQRYTISLSPAYVHSPTPRITVQPQHGIQVVLNSLSNDA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgactccagcagtaattgccagcgttgaaacaatgctagacaagtggcaagagaaagaa
ggagaagagatcgaagcgttccaaggatttagattgttgacttcagaagtcatatcaaga
acagcttttggtagcagttacttggaaggagagaagatcttttacatgttgcagaagctc
gcagatattgtgagccgcaatacaaacaagtctaggattccaatcctcagcaagttttgg
aaaactgacgatgacatagagtcagaaaaacttgctagagaaatacaagatttggtgata
gagattgtgaagaaaagagaaaacaaagttgcgagtggaggagcagagagcttcggctgt
gattttctgggattattagtaaaagcgtttaataatccagatgaaaaaaacaagatttca
atggaagatttggttgatgagtgcaaaacattttattttgccggacaagaaactgttaat
gcctcgcttgcttgggcagtgctggttttagctatccatagagattggcaagacaaagca
agaagagaggtgatggagatattcggtagccaatatccacacttcgaaggccttgccaaa
ctcaaaatcatgagcatgatcattaatgaaactctacgattgtatactcccttaaacggg
ttgttaagaagagctacaagacaagttcaagtgggaaagctagttttgcctgctaaagta
gaagttttgatcccaaacatggcacttcaccatgaccctcagttatggggagacgatgcc
catgttttcaaaccggagaggttcgaggaagggatcgcaaaagctaccaggtacaatgct
gctgcatttattcctttcggaatgggacctcgagcttgtgtcgggatgacctttgcaatc
aatgaaacaaagactgctctttccatgatcctacaaagatacaccatttctctctcccct
gcctatgttcactcacccacacctcgtatcacagttcaaccacaacatgggattcaagtt
gtactgaactcactgtctaatgatgcttaa

DBGET integrated database retrieval system