KEGG   Gossypium hirsutum (upland cotton): 107946218Help
Entry
107946218         CDS       T04793                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi00053  Ascorbate and aldarate metabolism
ghi00071  Fatty acid degradation
ghi00280  Valine, leucine and isoleucine degradation
ghi00310  Lysine degradation
ghi00330  Arginine and proline metabolism
ghi00340  Histidine metabolism
ghi00380  Tryptophan metabolism
ghi00410  beta-Alanine metabolism
ghi00561  Glycerolipid metabolism
ghi00620  Pyruvate metabolism
ghi00903  Limonene and pinene degradation
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107946218
   00053 Ascorbate and aldarate metabolism
    107946218
   00620 Pyruvate metabolism
    107946218
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107946218
   00561 Glycerolipid metabolism
    107946218
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107946218
   00310 Lysine degradation
    107946218
   00330 Arginine and proline metabolism
    107946218
   00340 Histidine metabolism
    107946218
   00380 Tryptophan metabolism
    107946218
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107946218
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107946218
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107946218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107946218
NCBI-ProteinID: XP_016735941
UniProt: A0A1U8NA24
LinkDB All DBs
Position
5
AA seq 531 aa AA seqDB search
MAAASRISSLLSRSLLSKGRICGLGRSVVCSYTTAAALEKPITPSINVNYTKLLINGNFV
DSASGKTFPTYDPRTGDVIAHVAEGDAEDINRAVSAARKAFDEGPWPKMTAYERSRVLFR
FADLIDQHTEELATLETWDNGKPYEQAAKIELPMISRLIRYCAGWADKIHGLTVPADSPH
LLQTIHEPIGVAGQIIPWNFPLLMFGWKVGPALACGNTVVIKTAEQTPLSALYAAKLLHE
AGLPPGVLNVVSGFGPTAGAALATHMQVDKLAFTRSTETGKIVLELAAKSNLKPITLELG
GKSPFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRS
VGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGDKGFYIQPTVFSNVK
EDMLIAKDEIFGPVQSILKFKDINEVIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGT
VWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcttcccgaatttcttccttgctttctcgttctctcctctctaaagggagg
atctgtggattgggcagatcagtggtttgtagctacaccaccgctgctgctttagagaaa
ccaatcactccttctatcaacgtcaactacaccaagcttttaattaatggcaactttgtt
gattctgcttcaggcaaaactttcccaacatatgaccccaggacaggagatgtgattgct
catgtagctgaaggtgatgctgaagatataaatcgagcagtttctgctgctcgaaaagcg
tttgatgaaggaccctggccaaagatgactgcttatgaaagatcaagggtattattccga
tttgctgatcttattgaccaacatactgaagaacttgcaacacttgagacttgggataac
ggaaagccatacgaacaagctgctaagattgaactacccatgatctcacgtcttattcgg
tactgtgctggttgggcggacaagattcatggtcttacagttccagcagatagtccacac
cttctgcaaaccatacatgaaccaattggtgttgctggtcaaattattccgtggaatttt
cctcttctaatgtttggttggaaggttggacctgccttggcatgtggtaatactgtcgtt
attaagacagctgagcagacaccattgtctgctctttatgctgccaagctacttcacgag
gctggacttcctccaggtgttctcaatgtggtttcagggtttggtccaactgctggtgct
gctcttgctactcatatgcaagttgacaagcttgctttcactagatcaactgaaacggga
aaaattgtccttgagttggctgcaaaaagcaaccttaagcccataacattggagctcgga
ggaaaatcgccttttattgtttgcaaggatgctgatgtcgacaaggcggttgagcttgcc
cactttgctttgttcttcaatcaaggacaatgttgctgtgctggctctcgtacatacgta
catgagagtgtgtatgatgaatttttagagaaggcaaaggcacgtgcattgaaacgtagt
gttggcgatccatttgtagcaggcattgaacaaggtcctcagattgattcagaacagttt
gaaaagatcatgaggtacataagatcaggtgttgaaagtggagcaactctagaaaccgga
ggggagaggataggggacaagggcttctatattcaacccacagttttctccaacgtgaag
gaggacatgttgattgcaaaggatgagatatttggtccagttcagtctatcctgaaattc
aaggacatcaacgaggttattcggagggcaaatacgacgtcatatggactggcagcgggt
gtgtttacgcaggacatagacacagcaaacaccttgacacgagcactgaaagtgggaaca
gtgtggataaactgctatgatgtgtttgatgcagcgatcccatttggtgggtacaagatg
agtggacaaggcagagaaaagggtattcactgtctcagcaattacttgcaagtgaaggcc
gttgtcactcccttgaaggaccctgcatggatttaa

DBGET integrated database retrieval system