KEGG   Gossypium hirsutum (upland cotton): 107951686Help
Entry
107951686         CDS       T04793                                 

Definition
(RefSeq) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ-like
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00061  Fatty acid biosynthesis
ghi00780  Biotin metabolism
ghi01100  Metabolic pathways
ghi01212  Fatty acid metabolism
Module
ghi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107951686
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107951686
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ghi01004]
    107951686
Enzymes [BR:ghi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     107951686
Lipid biosynthesis proteins [BR:ghi01004]
 Fatty acid synthase
  Component type
   107951686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 107951686
NCBI-ProteinID: XP_016742297
UniProt: A0A1U8NTJ2
LinkDB All DBs
Position
8
AA seq 221 aa AA seqDB search
MAVASNSLVSFIHGSLSQPGRTSHFLPSPSLSFPGSRSLSLKLTRRSNSPLLCSLDATNA
TDKDTPIETRFPAYPTVMDINQIREILPHRFPFLLVDRVIEYNPGVSAVGIKNVTINDNF
FPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGVDKVRFRKPVIAGDTL
VMRMTLIKLQKRFGIAKMEGKAYVGTDLVCEGEFLMATGST
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgcttccaactcgctcgtttctttcatccacggctcattgagtcaacccgga
aggacctcccactttcttccttcaccttctctttctttccccggatctcgctcgctctct
ctgaaactcacccgccgctccaactcgccccttctttgctctttagatgcaaccaacgcc
acagataaggacaccccaatcgaaacaaggttcccagcttatccaactgtgatggacatc
aatcaaataagagagatattaccacacagattcccattcttgttagtggatagagtgata
gaatataatccaggggtatcggctgttggtataaagaacgtgaccataaatgataacttt
ttccctggacatttccctgagaggcccataatgcctggtgttctcatggttgaggcgatg
gcccaagttggaggtctagttatgctgcaacctgaggtgggaggttctcgggaaaacttc
ttttttgctggagttgacaaagtaaggtttaggaaaccagtcattgcaggagatactttg
gttatgaggatgacacttattaagctgcaaaagcggtttggaatcgcaaagatggaaggg
aaagcatacgttggaactgacttggtatgcgaaggtgagttcttgatggctactggtagt
acttga

DBGET integrated database retrieval system