KEGG   Gossypium hirsutum (upland cotton): 107962380Help
Entry
107962380         CDS       T04793                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107962380
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107962380
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107962380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo FTA2 APH Pkinase_C Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 107962380
NCBI-ProteinID: XP_016754230
UniProt: A0A1U8PSX3
LinkDB All DBs
Position
11
AA seq 483 aa AA seqDB search
MVSSHLSSLNGSRLHKGFQNQLLFPTGQPDTPTSDHLEFDFSDVFGPASVQASTEISTEI
TKNLIVATESNELLYDDPAVICSRSHSLVGPSTYVSHSLKHSKLTLREIGDSLELVEGAR
DETQEELRKPSIDDVIPENPQGLVESQNQSVGLKDFEVLKVVGQGAFGRVYQVRRNDTSD
IYAMKVMRKDKIMEKNHAEYMKSERDILTKVDHPFIVQLRCSFQTKYRLYLVLDFVNGGH
LFFQLYRQGLFREDLARIYAAEIVSAVSHLHSNGIMHRDLKPENILLDAEGHVMLTDFGL
AKEFNENTRSNSMCGTLEYMSPEIVLGKGHDKAADWWSVGILLYEMLTGKPPFSGGNRQK
IQDKIIKEKIKLPAFLSSEAHSILKGLLQKDASKRLGSGQGGSEEIKRHKWFKSINWKKL
EARQIRPSFLPEVAGNQCIANFEECWTNMPVHDSPVASPTFGENPFKGFTYVRPAASFLN
RNA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctcacttatctagtttaaatgggtcccgcttgcacaaaggcttccagaat
cagttgctttttcccaccggacaacctgataccccgacctctgatcatcttgagtttgat
ttctctgatgtgtttggacctgcttcagttcaagcctcaactgaaatcagcacagagatt
accaaaaatctgattgtggcaactgaatcaaatgaactgctttatgatgatccagctgtt
atctgtagccgctcccactccttggttggcccctcgacttatgttagccactcattgaaa
catagcaagcttacattacgtgaaataggggattccttggaacttgtagaaggagctagg
gatgagactcaagaagagcttaggaaaccatcaattgatgatgttattccggagaaccct
caaggtcttgtagagagccaaaatcagtctgtaggactcaaagattttgaagttttgaag
gttgttggccaaggtgcttttggaagggtttatcaagtaaggaggaatgatacctcagac
atatatgcaatgaaggttatgcgcaaggataagattatggagaaaaatcacgctgagtac
atgaaatctgagagggatatattaacaaaagtggatcatcccttcattgtgcagctcaga
tgctccttccagaccaaatatagactgtaccttgtgcttgactttgttaatggggggcat
cttttcttccagctttatcgccagggcttattcagggaagatttggctcgcatatatgct
gcagagatagtatcagctgtttctcatctccattctaatggcataatgcacagggatctc
aaacctgagaatattcttctagacgcagagggacatgttatgctgactgatttcggcctg
gcaaaggaatttaacgaaaatacaagatccaattccatgtgtggaactctggaatatatg
tccccagaaattgttcttggcaaaggccatgacaaggcagctgattggtggagtgtggga
attctattgtatgaaatgcttactgggaagccaccctttagtggtggaaacagacagaag
atacaggataagataataaaggaaaagataaagctgccagcatttttgtctagtgaagca
cactcaattctcaaggggctgctgcagaaagatgcaagcaagcgtctcggcagtggacaa
ggtggtagcgaggagatcaaacggcataagtggttcaagtccattaactggaagaaatta
gaagctagacagataaggccaagttttctccctgaagttgccgggaaccaatgtattgcg
aatttcgaggagtgctggactaacatgccagttcatgattctccggttgctagcccaacg
ttcggggagaatccgttcaaagggttcacatatgtgaggcctgcagcctcatttcttaac
agaaatgcttga

DBGET integrated database retrieval system