KEGG   Gossypium hirsutum (upland cotton): 107962390Help
Entry
107962390         CDS       T04793                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ghi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107962390
Enzymes [BR:ghi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107962390
Chromosome and associated proteins [BR:ghi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107962390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 107962390
NCBI-ProteinID: XP_016754253
UniProt: A0A1U8PV56
LinkDB All DBs
Position
11
AA seq 429 aa AA seqDB search
MPATKKSSDCSHIGYAFNKLMKQIGHPVEFELPDCFNKWKDTPYTVIRRNVYLTKRIKRR
LEDDGIFCSCTSSSPGSYVCGRDCHCGMLLSSCSSGCSCGSSCLNKPFQHRPVKKLKLIK
TEKCGEGIVADEDIKHGEFVIEYVGEVIDDKTCEERLWNMKHRGETNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFAMRDIKKGEHLTYDYQFVQFGADQD
CHCGAAGCRQKLGVKPSKSKMSSDATLKLVACQVAVSSPTLKAVLFGNENGGLPVGTSQH
DYNQRQLRFRCCIGEVIKISRPINDSGITHLIHTYLFIHGAMTIGIFSQITCWVHLLGSL
SLTVTLELLNDLTSIQKSTWSCLKMVMLNFWICRKRIGSLSLCKVNFLGTVVEEEMLAKS
PIDQENDWI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctacaaagaagagttctgattgcagtcacattggctatgcattcaacaagttg
atgaagcaaattggacatccggttgagtttgaactgccagattgctttaataagtggaaa
gacacgccatacaccgttataaggcgcaacgtatatctcacaaagaggattaaaaggcgc
ctggaggatgatggaattttctgttcttgcacatcatcatcacctggttcttatgtgtgt
ggcagagattgccactgtgggatgctactgtctagttgctcttctggctgcagctgtggg
agttcatgcctcaataaaccattccaacacagacctgtcaaaaaactgaaattgattaag
accgagaaatgtggagagggcattgtagctgatgaagatatcaagcatggagagtttgta
atagaatatgtcggggaagttattgatgacaaaacatgtgaggagaggctttggaacatg
aagcatcgtggagaaaccaatttctacttatgtgaaatcaatcgtgatatggtaattgat
gccacatacaaggggaacaaatccagatatataaaccatagttgctgccccaatactgag
atgcagaaatggataattgatggtgaaacaaggattggcatatttgcaatgcgagatata
aaaaagggggagcatctgacctatgattatcagtttgttcaatttggtgcagatcaagat
tgtcactgtggtgccgctggctgcaggcaaaaacttggggtcaaacctagcaagtcaaag
atgtcatcagatgctacattaaagctagtagcatgccaagtggcagtgtcctctccaaca
ttgaaagctgtgctatttggaaatgaaaatggaggtttgcctgtcggaacttctcagcat
gattataatcaacgacagttacgttttcggtgttgcattggtgaagtgataaaaatatct
cgtccaataaatgatagtggaataacacatttgattcacacttatcttttcatccatggt
gccatgaccattggaattttctcccagataacatgttgggtccatcttcttgggagctta
agtcttactgttactttggaattattaaacgatttgacaagtattcaaaaaagcacctgg
tcatgtttgaagatggtgatgttgaatttctggatctgtcgaaagaggattgggagctta
tcactttgtaaggtcaattttttaggtactgttgttgaagaagaaatgctagcgaaaagc
ccgatagaccaagaaaatgactggatttga

DBGET integrated database retrieval system