KEGG   Grimontia hollisae: AL542_03395Help
Entry
AL542_03395       CDS       T04260                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
gho  Grimontia hollisae
Pathway
gho00061  Fatty acid biosynthesis
gho00620  Pyruvate metabolism
gho00640  Propanoate metabolism
gho01100  Metabolic pathways
gho01110  Biosynthesis of secondary metabolites
gho01120  Microbial metabolism in diverse environments
gho01130  Biosynthesis of antibiotics
gho01200  Carbon metabolism
gho01212  Fatty acid metabolism
Module
gho_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL542_03395
   00640 Propanoate metabolism
    AL542_03395
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AL542_03395
Enzymes [BR:gho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AL542_03395
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AL542_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_5 PTS_IIB ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AMG29481
LinkDB All DBs
Position
2:754500..755909
Genome map
AA seq 469 aa AA seqDB search
MTIEKLLIANRGEIAVRIIRAAKEMGIHTVQVYSEADKDSLAVMLADDAICIGAPMASQS
YLCGDKVIQAAKASGADAIHPGYGFLSENARFSDDVRAADIIFVGPSGQTMTKMADKARA
RETAVAAGVPVVPGNAPAANPDAALKQARQIGFPVMIKASAGGGGRGIRVIEQEGEFLTQ
YHQASAEAQSAFGDGTLYLEKFIRQSRHVEVQILADGENAVHLFERECSLQRRRQKVWEE
APCAVLPDRVREAMCQSAVSLAKSVNYKGAGTIEFLYDEESESFYFIEMNTRIQVEHPIT
EAITGVDLIREMIQIAAGQPLSFKQEDIQRRGHAIEIRLNAEDPFNGFLPFPGVISSFTP
PMGSGVRFDGLIYSGFAIPPYYDSLLGKLIVWDEDRERAIQRMARALDELSVEGVKTTQP
LFQKLCEAPDVIRGDFHTAWLEQWLETLNAPKPETPPDNKKDCSLPEAS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaaaactgctcatcgccaaccggggtgagatagccgtacgtattattcgt
gcggccaaggagatggggattcataccgtgcaggtttacagtgaagcggataaagactcc
cttgctgtgatgcttgccgatgatgccatttgtattggtgcgcccatggccagccaatcc
tacctttgtggcgacaaagttattcaggccgcaaaagcgtccggtgccgatgccattcat
cccggctacgggtttctctctgaaaacgcccgcttctccgatgacgtgcgcgcagcagac
atcatctttgttggcccttcaggacaaaccatgaccaagatggcggataaagcccgagcc
cgtgaaaccgcggtggcggcaggtgtgcctgtggttcccggcaatgcgcctgccgctaat
cctgacgcggcgctcaagcaggccagacaaatcggtttcccagtgatgatcaaagcctcg
gcgggtggtggaggccgcggtatccgggtgattgagcaagaaggtgagttcttaacccaa
taccatcaggcatcggccgaagcgcagtctgcgtttggtgatggcacgctttatctggag
aaattcattcgccagtcccgccatgtcgaagtgcagatccttgccgatggcgaaaacgcg
gtccacctgtttgaacgtgaatgttcactgcaacgccgccgccagaaagtctgggaagaa
gccccctgtgctgtcttgccggatcgggtacgtgaagccatgtgccagtctgcggtgtcg
ctggcgaaaagcgtgaattacaaaggtgcgggcaccattgagtttctctacgacgaggaa
tctgaatccttctatttcatcgaaatgaatacccgcattcaggtcgagcaccccatcacg
gaagccatcacaggtgtcgacctgatccgggaaatgatccaaatagccgcaggtcagccc
ctttctttcaaacaggaagacattcagcgccgcggccatgccattgaaatccgcctgaat
gcggaagacccattcaacggcttccttccttttcccggtgtgatctcttcgttcacaccg
ccgatgggaagtggcgtgcgctttgacgggctcatctattccggctttgccattcccccc
tattacgactccctgctaggcaaattgatcgtatgggatgaagacagggagcgtgcgatt
cagcgcatggcaagggcgctggatgagctctccgttgaaggcgtcaaaaccacccaacca
ttgtttcaaaaactctgtgaagcgccggatgtcattcgcggcgatttccatacggcctgg
cttgaacagtggctggagacactcaacgccccaaagcctgaaaccccacctgacaacaag
aaggactgctcgctccccgaagcaagctaa

DBGET integrated database retrieval system