KEGG   Grimontia hollisae: AL542_04460Help
Entry
AL542_04460       CDS       T04260                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
gho  Grimontia hollisae
Pathway
gho00020  Citrate cycle (TCA cycle)
gho00190  Oxidative phosphorylation
gho00650  Butanoate metabolism
gho01100  Metabolic pathways
gho01110  Biosynthesis of secondary metabolites
gho01120  Microbial metabolism in diverse environments
gho01130  Biosynthesis of antibiotics
gho01200  Carbon metabolism
Module
gho_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gho_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL542_04460 (sdhB)
   00650 Butanoate metabolism
    AL542_04460 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AL542_04460 (sdhB)
Enzymes [BR:gho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AL542_04460 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AL542_04460 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AMG29718
UniProt: A0A377HLT6
LinkDB All DBs
Position
1:complement(209404..210117)
Genome map
AA seq 237 aa AA seqDB search
MKLNFSVYRYNPDVDDAPHMKGYTLEVPDGSDMMVLDALILLKEQDPTLAFRRSCREGVC
GSDGINMNGKNGLACITPLSALMTDQSSIVIRPLPGLPVVRDLIIDMSQFYQNYERVKPY
LINDSAPPARENLQSPDDRAHLDGLYECIMCACCSTSCPSFWWNPDKFVGPAGLLAAYRW
LIDSRDTATDERLSDLDDAFSVFRCHSIMNCVNVCPKGLNPTKAIGHIRSMLLKRAV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaacttttctgtatatcgttacaacccggacgttgatgacgcgccacacatg
aagggctacaccttggaagtgcctgatggctcggacatgatggtgctggatgcattgatc
ctgctgaaagagcaagatccaacactggcctttcgtcgctcttgccgtgaaggggtatgt
ggttcagacggcatcaacatgaacggcaaaaacggattggcgtgtattacaccactgtca
gcactgatgactgaccagtcgagtatcgtgatccgtccgctaccggggttgccggtagtg
cgtgatctgattattgatatgagccagttctaccaaaactatgagcgtgtgaaaccgtat
ctcatcaatgacagtgcaccgcctgcgcgcgaaaacttgcaatcgccggatgatcgtgcg
catcttgacggtctctatgagtgtatcatgtgtgcatgttgcagcacgtcttgcccgtct
ttctggtggaacccagataagtttgttgggccggctggtctgcttgctgcatatcgttgg
ctgattgacagccgtgataccgcaacagacgagcgtttatcagatctggacgacgctttt
agtgttttccgttgccatagcatcatgaactgtgtaaatgtttgtcctaaagggctaaat
cctacgaaagcaatcggccatattcgttcaatgctgcttaaacgcgcagtgtaa

DBGET integrated database retrieval system