KEGG   Grimontia hollisae: AL542_04465Help
Entry
AL542_04465       CDS       T04260                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
gho  Grimontia hollisae
Pathway
gho00020  Citrate cycle (TCA cycle)
gho00190  Oxidative phosphorylation
gho00650  Butanoate metabolism
gho01100  Metabolic pathways
gho01110  Biosynthesis of secondary metabolites
gho01120  Microbial metabolism in diverse environments
gho01130  Biosynthesis of antibiotics
gho01200  Carbon metabolism
Module
gho_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gho_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL542_04465
   00650 Butanoate metabolism
    AL542_04465
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AL542_04465
Enzymes [BR:gho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AL542_04465
    1.3.5.4  fumarate reductase (quinol)
     AL542_04465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4 BEX FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMG29719
UniProt: A0A377HMP9
LinkDB All DBs
Position
1:complement(210133..211899)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAIVIGAGGAGMRAALQISEQGLSCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQNAIEYMCKTGPQSIIELEKMGLPFSRFENGSIYQRPFG
GQSKAFGGEQAARTAAAADRTGHALLHTLYQQNIKNKTTIFSEWYALDLVKNQDGAVVGA
TAMDMESGEICYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMVEIREG
RGCDGPWGPHIKLKLDHLGKDVLEARLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGV
PTQVSGQAIKQDANGNDVEVQGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLAAQVEARDASESDIEASLARVNRWNSTQKGEDPVQIRKDLQSCMQNNFSVFREGDAM
AKGLEELKVIRERLKEARLDDTSSEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAH
ARFDYQERDDENWLCHTIYNPETESMSKRDVNMTPVHREAFPPKARTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattccagtaagagagttcgacgcaattgttatcggtgcgggtggtgcaggcatg
cgcgcggcactgcaaatttctgagcagggcttatcgtgtgcgctgctgtctaaagtattt
ccgacccgttcccatacagtatctgcccaaggtggcattactgttgctctgggtaattcc
cacgaggataactgggaatggcacatgtatgacactgtaaaagggtcagattacatcggt
gaccaaaatgcgattgagtacatgtgtaaaacaggccctcagtccattatcgaacttgag
aaaatgggcttgccattctcccgctttgaaaacggttctatctatcaacgtccattcggt
ggtcagtcaaaagcgtttggcggcgagcaagctgcacgtaccgcagcggcggctgaccgt
acaggccacgcgctgcttcataccctgtaccaacagaatatcaaaaacaaaaccaccatc
ttctctgagtggtacgcactggatctggtgaaaaaccaggatggtgcagtagtcggtgca
acggcgatggacatggaaagcggcgagatctgctacttcaaagccaaggcaacggtgctg
gcgacaggcggcgcaggccgtatttaccaatccacgacaaacgcacatatcaacacaggt
gacggtgtgggtatggcattgcgtgcaggtgtaccaatgcaagacatggaaatgtggcag
ttccacccaaccggcattgccggtgccggtgtactggttactgaaggttgccgtggtgaa
ggtggttatctgctgaataaagacggcgagcgcttcatggagcgctatgcaccaaatgcc
aaagatctcgcaggccgcgatgttgttgcgcgttctatgatggtcgaaatccgtgaaggt
cgcggttgcgatggcccttggggtccacacattaaactgaaactggatcacttaggcaaa
gacgtactcgaagcacgtctgccgggtattcttgagctgtcacgtacatttgcacatgtt
gacccaatcaaagagccaattccagttatcccaacctgtcactacatgatgggtggtgtc
ccaacacaggtgtctggacaggcgatcaagcaagacgccaacggcaatgatgtggaagta
cagggcctgtttgcctgtggtgaaatcgcaagcgtttctgtccatggtgcaaaccgtctg
ggtggtaactcgctgcttgaccttgttgtattcggtcgcgcgaccggtctgcacttgggt
gaaaccttggcagcgcaggttgaagcgcgtgatgcgtctgagtctgatattgaagcatct
ctggcgcgtgttaatcgctggaattcaacccagaagggtgaagatccggttcaaattcgt
aaagacctccagtcctgcatgcagaacaatttctcggtattccgcgaaggtgatgcaatg
gcgaaaggtctggaagagctgaaagttattcgtgagcgtctgaaagaagcacgtctggat
gacacctcctcagaattcaatacacagcgcattgagtgcctggagttggataacctgatg
gaaaccgcattctctaccgcagtcgcagcaaactaccgcacagaaagccgtggtgcacat
gcccgctttgattaccaagagcgtgatgatgaaaactggctgtgccacaccatctacaac
ccggaaacagagtcgatgtccaagcgtgatgtcaacatgacacctgttcatcgtgaagct
ttcccgccgaaagcgcgtacttactaa

DBGET integrated database retrieval system