KEGG   Grimontia hollisae: AL542_04725Help
Entry
AL542_04725       CDS       T04260                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gho  Grimontia hollisae
Pathway
gho00220  Arginine biosynthesis
gho00250  Alanine, aspartate and glutamate metabolism
gho00290  Valine, leucine and isoleucine biosynthesis
gho01100  Metabolic pathways
gho01110  Biosynthesis of secondary metabolites
gho01130  Biosynthesis of antibiotics
gho01210  2-Oxocarboxylic acid metabolism
gho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL542_04725
   00290 Valine, leucine and isoleucine biosynthesis
    AL542_04725
   00220 Arginine biosynthesis
    AL542_04725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gho01007]
    AL542_04725
Enzymes [BR:gho01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AL542_04725
    2.6.1.66  valine---pyruvate transaminase
     AL542_04725
Amino acid related enzymes [BR:gho01007]
 Aminotransferase (transaminase)
  Class I
   AL542_04725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMG29764
UniProt: A0A377HL23
LinkDB All DBs
Position
1:265207..266421
Genome map
AA seq 404 aa AA seqDB search
MKEIGMSTKLDNVCYDIRGPIMKEAKRLEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQKRGMLELDVEDVYLGNGVSELIVMAMQALLNSGD
ELLVPSPDYPLWTAAVSLSGGKPVHYLCDEASDWYPDLDDIKAKITPNTKGIVLINPNNP
TGAVYSRDFLMQIAEIARQHNLIIFADEIYDKILYDGAQHHSIAPLAPDVFCVTFSGLSK
SYRVCGFRSGWMILSGPRHLAKGYISGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDKAHELLNQIPGISCVKPKGALYLFPKIDTKKYSIHNDEKMMLDFLLQEK
VLMVHGTGFNWHKPDHFRIVSLPRVDDLEVAIGRFERFLSTYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatcgggatgtcgacaaagctggataacgtctgttacgacattcgtggtcca
ataatgaaagaggcaaagcgcctcgaagaagaaggccataaaattctcaaactgaatatt
ggcaaccctgccccctttggcttcgacgccccggatgaaattctggttgacgtgatccga
aatctgccaacttcccaggggtactgtgattctaaagggatctactctgcacgtaaggcg
gtggttcaacactaccagaaacgcggtatgctggagctggatgttgaggacgtctatctg
ggtaacggtgtgtctgagttgattgtgatggcgatgcaggcactgttgaacagcggcgac
gagctgctggtgccttcgccggactatccactgtggacggcggctgtatcgctctctggc
ggtaaacccgttcattacctgtgtgatgaagcgtcagactggtatccggatctcgatgac
atcaaagcgaaaatcaccccgaataccaagggtattgttctgatcaacccgaataacccg
accggtgccgtttacagccgtgattttctgatgcagattgctgagattgcgcgccagcat
aatctcatcatttttgccgatgaaatctacgacaagatcctgtatgacggtgcgcagcat
cattccattgccccactggcgccagatgtgttctgcgtgaccttcagtggcctgtcgaaa
tcttaccgtgtgtgcggtttccgctcaggctggatgatcctgtcaggcccgcgtcactta
gcaaaaggctacatttctggcctggatatgttggcctctatgcgtctttgcgccaacgtg
ccgatgcagcatgctatccaaactgcgctgggcggctaccagagtatcaatgaactgatt
ttgcctggtggccggttgctggaacagcgtgataaagcgcatgaactgttgaaccaaatt
ccagggatcagttgcgtgaaaccgaaaggggctctgtacctgttccctaaaatcgacacc
aagaaatacagcattcacaatgacgaaaagatgatgctggatttcctgctgcaagaaaaa
gtgttgatggtgcacggcaccggctttaactggcacaagccggatcatttccgcattgtc
tcgctgccgcgcgtcgacgatttggaagtggctattggccgctttgaacgcttcctgtcg
acgtatcgtcagtaa

DBGET integrated database retrieval system