KEGG   Grimontia hollisae: AL542_14295Help
Entry
AL542_14295       CDS       T04260                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gho  Grimontia hollisae
Brite
Enzymes [BR:gho01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AL542_14295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMG31395
UniProt: A0A377HQM1
LinkDB All DBs
Position
1:complement(2288502..2289086)
Genome map
AA seq 194 aa AA seqDB search
MAFQLPALPYEKNALEPHISQETLEFHHGKHHNTYVVKLNGLIEGTELENKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLSPNGGGEPTGDVADAIAKSFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLDIVNTSNAGTPLTEEGVTPLLTVDLWEHAYYIDFRNLRPDYMNAFW
ALVNWEFVAQNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaactaccagctcttccttacgagaaaaacgcgcttgagccacacatttcc
caagagactctggaattccaccacggcaagcaccacaacacttacgttgttaagctgaac
ggcctgatcgaaggtactgagcttgagaacaaatctctggaagagatcatcaaaacgtct
accggtggtgtgttcaacaacgcagcacaaatctggaaccacactttctactggcactgc
ctgagcccaaatggtggcggcgagccaaccggtgatgttgcagacgcaatcgcaaaatct
ttcggttcattcgaagagttcaaagcgaagttcactgattccgccatcaacaacttcggt
tcttcctggacctggctggtgaaaaaagctgacggttctctggacatcgttaacacgtct
aacgctggcacccctctgactgaagaaggtgtcacaccactgctgactgttgacctgtgg
gaacacgcttactacatcgacttccgtaacctgcgtccagattacatgaatgcattctgg
gcactggttaactgggaatttgtagcacaaaacctggctgcttaa

DBGET integrated database retrieval system