KEGG   Grimontia hollisae: AL542_16435Help
Entry
AL542_16435       CDS       T04260                                 

Definition
(GenBank) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gho  Grimontia hollisae
Pathway
gho00020  Citrate cycle (TCA cycle)
gho00310  Lysine degradation
gho00380  Tryptophan metabolism
gho01100  Metabolic pathways
gho01110  Biosynthesis of secondary metabolites
gho01120  Microbial metabolism in diverse environments
gho01130  Biosynthesis of antibiotics
gho01200  Carbon metabolism
Module
gho_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL542_16435
  09105 Amino acid metabolism
   00310 Lysine degradation
    AL542_16435
   00380 Tryptophan metabolism
    AL542_16435
Enzymes [BR:gho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AL542_16435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PYNP_C DUF896
Motif
Other DBs
NCBI-ProteinID: AMG31768
LinkDB All DBs
Position
1:2768697..2770106
Genome map
AA seq 469 aa AA seqDB search
MDIIMPQLGETVAEGEILAWHKAEGDSVKKGDVLFEISTDKVAMEVPAMEEGVLTNIFAQ
VGEVITVGEPVGEMAVEGEEAKVAEPAKDIIEQQTTASEPSKPAAIQTFSQQGHGLLSPA
VKYLTRQHDLDLSEIEGTGSNGRITKRDVQAFVAQQQQGEMAAIDDEAIAFMSPSVRRLV
TEHDVDVNQIEGSGKHGRITKEDVLGYLDGGETVATRSVTTSQVMKAEPQPVSITGQDVP
FSFMRKQIARQMSSSKDNAVHVAQGMEISFDEVEAVRQQHKADFKQKYGVSLTPLAFIAR
AVVKALQEFPQLNGQVSGEKLVLSAPVHLGIAVDLNHKGLVVPVIKDADTMNVSGLARKI
AELAKKARENRLTPDEMSGATYTLSNNGGAGTVFTTPIINHPEIAILSIDGISRKPVVVN
VNGRESLGIGSVGMVVQSFDHRAVDGAYSGAFLQRVKSLLESHGWQAEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggatattattatgccccaactgggggaaaccgtcgcagaaggtgaaatcctcgcctgg
cataaagccgagggtgacagcgtcaagaaaggtgatgtgttgtttgaaatctccaccgac
aaggtggcgatggaagtgccggcaatggaagaaggtgtgctgaccaacatcttcgcccag
gtgggtgaggtgattactgtgggcgaacctgttggtgaaatggctgtggaaggtgaagag
gcgaaagtcgctgagcctgccaaagacatcatcgaacaacagacaacggcttcagaaccc
tcaaaaccggctgcgatccagactttctcacagcaaggtcatgggttactgtcacctgcg
gtgaagtacctgacccgccagcacgatctggacttgtctgagattgaaggaacgggcagc
aatggccgaatcaccaaacgtgatgtgcaggcgttcgttgcacaacaacagcaaggtgaa
atggctgcgattgacgatgaagccatagcgttcatgtctccctctgtcaggagactggtg
acggaacatgatgttgatgtcaatcaaatcgaaggttccggaaagcatggccgcatcacc
aaagaagatgtgctgggttatctggatggtggagaaacagtcgcgactcggtctgtgaca
acgtcacaagtgatgaaggctgaaccacaacctgtttcgattaccggccaagacgtgccg
ttttccttcatgcgtaagcagattgcccgtcaaatgtcgtcgtcgaaagacaatgctgtt
cacgtcgcgcagggaatggaaatctcgtttgatgaagtagaagcggtgcgccagcaacac
aaagcagatttcaaacagaaatacggtgtcagcctgacgccgctggcgtttatcgcccgg
gcggtggttaaggcattgcaggagttcccacaactcaacggtcaggtcagtggtgagaaa
ctggtgcttagtgcaccggtgcatctgggcattgctgtcgatttgaatcacaaggggctg
gtcgtgcctgtgattaaagatgctgacaccatgaatgtctctggtctggcacggaaaatt
gctgaattggcgaaaaaagcccgggaaaaccggttgacgcctgacgaaatgagcggcgcc
acctacaccttgtccaataatgggggggcgggaaccgtgttcacgacaccgattatcaat
cacccggaaatcgccattctttctattgatggcatcagtcgcaagcctgttgtcgtcaat
gtgaatggaagggaaagcctggggattggcagcgttggtatggtggttcaatcctttgac
caccgtgccgtcgatggcgcctattcaggtgcgtttttgcagagagtcaaatctctcctg
gagtcccacggatggcaagcagagctataa

DBGET integrated database retrieval system