KEGG   Grimontia hollisae: AL542_16825Help
Entry
AL542_16825       CDS       T04260                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
gho  Grimontia hollisae
Pathway
gho00630  Glyoxylate and dicarboxylate metabolism
gho01100  Metabolic pathways
gho01120  Microbial metabolism in diverse environments
gho01200  Carbon metabolism
Module
gho_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:gho00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AL542_16825
Enzymes [BR:gho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AL542_16825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AMG31840
LinkDB All DBs
Position
1:complement(2857913..2858272)
Genome map
AA seq 119 aa AA seqDB search
MSEVMDYASRLTDPHSRKFETFSYLPRMTADQIRRQVEFIVSKGWNPAIEHTEPDEAGGA
YWYMWKLPMFGETNVDHILNEAQLCHNLNPNHHVRLVGYDNDKQSQGASMVIYRAPGFE
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtcatggattatgcatcacgcctgactgacccacacagcaggaagttcgaa
accttttcgtacctgccccggatgacagcggatcaaattcgccgtcaggttgaatttatt
gtcagcaaaggctggaaccccgcgattgaacacaccgagcccgatgaagcgggcggcgct
tattggtatatgtggaaattgcctatgttcggtgaaaccaatgtcgatcacatccttaat
gaggctcagctttgccataacctgaatcctaatcaccatgtgcgattggtcggttatgac
aatgataaacagagtcagggagcatcaatggttatctaccgtgcgcccggattcgaatag

DBGET integrated database retrieval system