KEGG   Grimontia hollisae: AL542_18245Help
Entry
AL542_18245       CDS       T04260                                 

Definition
(GenBank) PTS glucose transporter subunit IIBC
  KO
K02778  PTS system, glucose-specific IIB component [EC:2.7.1.199]
K02779  PTS system, glucose-specific IIC component
Organism
gho  Grimontia hollisae
Pathway
gho00010  Glycolysis / Gluconeogenesis
gho00520  Amino sugar and nucleotide sugar metabolism
gho01100  Metabolic pathways
gho02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL542_18245
   00520 Amino sugar and nucleotide sugar metabolism
    AL542_18245
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    AL542_18245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gho02000]
    AL542_18245
Enzymes [BR:gho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     AL542_18245
Transporters [BR:gho02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    AL542_18245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: AMG32083
LinkDB All DBs
Position
1:complement(3210024..3211454)
Genome map
AA seq 476 aa AA seqDB search
MFKNLFASLQKVGKALMLPVSVLPVAGILLGVGAADFSWLPSIVSGIMESAGGSVFGQMP
LLFAVGVALGFTNNDGVAGLAAIVGYGIMSATLGVMAQVLGVDKIDTGVLGGILVGGAAA
WAFNRFFRIQLPDYLGFFAGKRFVPIMTGFCAIGLGLALSVIWPPVGAAIGSFSHWAANQ
NPVMAFGIYGIVERSLIPFGLHHVWNVPFFFEAGSCVNAAGEARTGVLTCYLEADAISRA
AGNGFGQLAGGFMFKMFGLPAAAIAMWHTAKPENRAKVGGIMVSAALTSFLTGITEPIEF
AFMFVAPVLYAIHAVLAGTAYVLTNMLGMVHGTSFSHGLIDFLVLSANSQKLWLFPLLGL
GYAVFYYVVFRIAIVKLDLKTPGREDEDKNAAAAGGESEMAKELVMAFGGKDNITGLDAC
ITRLRVSVASVDKVDQDKLKKLGAAGVVVAGSGVQAIFGTKSDNLKSDMDEWIRNN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaacctgtttgctagcctgcagaaagtcggtaaggcgcttatgctccctgta
tcggttctgccggtagcaggtattttactgggcgttggtgccgcagactttagttggttg
ccaagtattgtatctgggatcatggaaagtgccggtggttctgtatttggccaaatgcct
ttgctgtttgccgtcggtgttgcattgggttttacgaataatgatggcgtagcaggtctt
gctgcaattgttggttatggcatcatgtcagcgacgttgggtgtcatggcacaggtgttg
ggtgtagataaaatcgatactggcgtattaggtggtattctggttggtggtgcggctgct
tgggcattcaaccgtttcttccgcatccagttgccagattacctgggcttttttgcgggt
aaacgctttgtacctatcatgacaggtttctgtgctattggtctgggtctggcactctct
gttatttggccaccggttggtgctgcaatcggttcgttttctcattgggcagcgaaccaa
aaccctgttatggctttcggtatttacggtatcgttgagcgttcacttatcccatttggt
ctgcaccacgtctggaacgtccctttcttctttgaagcaggctcgtgtgtgaatgcggca
ggtgaagcgcgtaccggtgttctgacttgctatctcgaggcggatgctatctcccgtgca
gcaggtaatggctttggccagttggcgggtggtttcatgttcaagatgtttggtctgcca
gctgcagccattgctatgtggcacactgcaaagccagaaaaccgcgcgaaagttggcggt
atcatggtttcagcagcattgacctcattcctgacgggtattactgaacctatcgagttc
gcattcatgtttgttgcgcctgtgctgtatgctattcacgcggtgttggcaggtacggct
tatgtgctgacaaatatgttgggtatggttcacggtacatcgttctcccacggtttgatt
gacttcctggtgttgtctgcaaactctcagaaactgtggctgttcccgctgctgggtctg
ggctatgccgtgttctactatgtcgtgttccgcattgctatcgttaagctggatctgaaa
acgccaggtcgtgaagatgaagataagaatgcagccgctgcgggtggtgagtctgaaatg
gcgaaagagctggttatggcatttggtggtaaagacaacattaccggtctggatgcttgc
attacccgtttgcgcgtatcggtagcgagcgttgataaagttgaccaggacaaactgaag
aaactgggcgcggcaggtgtagtggttgctggtagcggtgttcaggctatttttggtact
aagtctgacaacctgaaatcagacatggatgaatggatccgcaataactga

DBGET integrated database retrieval system