KEGG   Gordonia iterans: C6V83_02555Help
Entry
C6V83_02555       CDS       T05370                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
git  Gordonia iterans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AVL99337
UniProt: A0A2S0KCC0
LinkDB All DBs
Position
567621..568715
Genome map
AA seq 364 aa AA seqDB search
MDLPVNPPVAPMLAKAVTAVPAQPDSDPVWSYEPKWDGFRALVFRDGDEVAISSRGGKDL
ARYFPELVEAARQELPERVVLDGEVGVPRNVSTGERIRRLDWDSLSQRIHPAASRIAKLS
EETPAIFIGFDALASGDRALLDEPFAVRREVLAESVRAGADSRFLLSRVTRDAAQAQDWF
TAFEGAGLDGVVAKKLAASYVPGKREMVKVKHKRTADCVVLGYRVHKSGTGLGSMLLGLY
DDAGEVRMVGGSSAFSDAKRIELQQEFEKLRLSPDAVSPGEVNRWRSSAQGAKGAGQSQS
ATGEWIPIRQELVAEVAYDQMENGRFRHTVKFVRWRPDREPSSCTYDQLEVPLTYDLYDV
IEGV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggacctccccgtgaacccgcccgtcgcaccgatgctggcaaaggcggtcaccgccgtt
ccggcgcagccggacagtgatccggtctggtcgtacgagccgaagtgggatggtttccgc
gcgttggtgtttcgcgacggcgacgaggtggcgatatcctcgcgcggcggcaaggacctc
gcacggtacttccccgaactggtcgaggccgcccggcaggagctgccggaacgggtcgtg
ctcgacggcgaggtcggcgttccgcggaacgtctcgacaggcgagcggatccgcaggctc
gattgggattcgctgtcgcagcggattcatcccgcagcgtcgaggatcgccaagctctcc
gaggagaccccggcgatcttcatcgggttcgacgccctggcgtccggcgaccgcgcgttg
ctcgacgagccgttcgcggtgcggcgcgaggtgctcgccgagtcggtccgcgccggggcg
gattcgcgctttctgctcagccgggtcacccgggacgccgcgcaggcgcaggactggttc
accgcgttcgagggcgcgggcttggacggcgtcgtcgccaagaagctggcggcgtcgtac
gtgccgggcaagcgcgagatggtcaaggtcaagcacaagcgcaccgccgactgcgtggtg
ctcgggtaccgcgtgcacaagagcggcacgggcctcggatccatgttgctcggactttac
gacgatgccggtgaggtccggatggtcggcggatcgagtgccttctcggacgcgaaacgc
attgagctgcagcaggagttcgagaagctccggttgtctcccgacgccgtctcgccgggc
gaggtgaaccgctggcggtcgtcggcgcagggggctaagggagcgggtcaatcccagtcg
gcgaccggcgagtggatcccgatccggcaggagttggtggccgaggtcgcctacgaccag
atggagaacgggcggttccggcacaccgtgaagttcgtgcgctggcggccggaccgcgag
ccgtcgtcgtgcacctacgaccagctcgaagtgccgctcacgtacgacctctacgacgtc
atcgagggagtctga

DBGET integrated database retrieval system