KEGG   Gordonia iterans: C6V83_10850Help
Entry
C6V83_10850       CDS       T05370                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
git  Gordonia iterans
Pathway
git00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:git00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C6V83_10850
Enzymes [BR:git01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C6V83_10850
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C6V83_10850
    1.1.1.-  
     C6V83_10850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc adh_short FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AVM00695
UniProt: A0A2S0KG84
LinkDB All DBs
Position
2364132..2365193
Genome map
AA seq 353 aa AA seqDB search
MRAARYYDRHDVRIEDVPEPELAPGTVAVEVAWCGICGTDLHEYLEGPIFIPPAGHPHPL
SGESAPVVIGHEFSGTVIALGEGVDDLSVGENVVIEPYIIGDDVDTGPGSDYQLSKDMNF
IGLGGRGGGLAEKIVVRRRWVHPIGDIPLDQAALIEPLSVGHHAFVRSGAKAGMTAIVGG
AGPIGLLTAAVLKAEGLTVYISELSDARKAMARKTGVADEVFDPRDGDVAEKVRQLTDGR
GADVGFECSSVPAVLDMLIDAVRPGGVIVNVSIWGHEPPVDMPKLVLKELDLRGTIGYAN
DHPATIALVQSGKLDLAPFITGRIALDELVSKGYDQLINNNEEHVKIIVNPHA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcccgctactacgatcgccacgacgtccgcatcgaggacgtccccgaaccc
gagctcgcgcccggcaccgtcgccgtcgaggtcgcgtggtgcggaatctgcggcaccgat
ctgcacgagtacctcgaaggccccatcttcattccgccggccgggcatccgcatcccctc
tcgggggagtccgcgccggtcgtgatcgggcacgagttctccggtaccgtcatcgcgctc
ggggagggcgtcgacgacctcagcgtcggcgagaacgtcgtcatcgagccgtacatcatc
ggtgacgacgtcgacaccggccccggctcggactaccagctgagcaaggacatgaacttc
atcggtctcggcggccgtgggggaggtctggcggagaagatcgtcgtgcgacgacggtgg
gtgcacccgatcggcgacatcccgctcgatcaggccgcgctcatcgaaccgctctcggtc
ggccatcacgcgttcgtgcgttcgggggcgaaggccggcatgaccgcgatcgtcggcggc
gccgggccgatcggcctgctgaccgcggccgtcctcaaggccgagggcctcaccgtctac
atctccgaactgtcggacgcgcgcaaggcgatggcacgcaagacgggcgtcgccgacgag
gtcttcgatccgcgcgacggagacgtcgccgagaaggtgcgccagctgaccgacggtcgc
ggcgccgatgtcgggttcgaatgttcttccgtccctgccgttctcgacatgctgatcgat
gccgtccgtccgggaggagtgatcgtgaacgtgtcgatctgggggcacgagccgcccgtc
gacatgccgaaactggtcctcaaagaactcgatctgcgcggcaccatcggctacgccaac
gaccacccggccaccatcgctctggtccagagcggcaagcttgatctcgccccgttcatc
accggccgcatcgccctcgacgagttggtcagcaagggctacgaccagctgatcaacaac
aacgaggagcacgtcaagatcatcgtgaacccgcacgcctga

DBGET integrated database retrieval system