KEGG   Gekko japonicus: 107105480Help
Entry
107105480         CDS       T04299                                 

Gene name
EHMT2
Definition
(RefSeq) euchromatic histone lysine methyltransferase 2
  KO
K11420  [histone H3]-lysine9 N-trimethyltransferase EHMT [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107105480 (EHMT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107105480 (EHMT2)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107105480 (EHMT2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107105480 (EHMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 Pre-SET SET TFIIA CDC45
Motif
Other DBs
NCBI-GeneID: 107105480
NCBI-ProteinID: XP_015260943
LinkDB All DBs
Position
Un
AA seq 1150 aa AA seqDB search
MEAAGAGATQGEPSRGAPGATSLVEVGADDTGVIPLRESSDPSSGSLSPRKTKTSLGGTG
DSLPTTGRNCDDGARIQMTSCGKEAGGMSPELGAVSAGSNASPSPGNKGLPGHAAKTFPS
SPSKAGGPSRAKMSLTGASKSPTSVQSLAMRLLSMPGSRLPGDAATPSTEASPPAPPPAP
AQTPAPAAEEAKPKVHRARKTMSKPNTGQVPEKRVSEMLHFRVPDDLRSIEEPEEPAKRR
KYDYMTDAMHKRMPLSLHRSSPRATTEITVTEEMAAPATASQEERTQEWETEVGDDFSLY
YDSYSVDGHVDSDSKEEDDDEDEDEDDEESGNLSDRSVASSSRRKARKRWRNDSPWVKPS
HKRKRKEPHPKDTRGLNGGPSATQSEYTEVPLGCLELPNEGTLSPNNAGVSNETSSLETE
RFEELPLCSCRMEAPSIERLSQQAGNQCMATESADGELSGCSSSILKRETMRPSSRVPLM
VLCETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMIFCPHCGE
DASEAQEITIAKADTSTPVPVPPSHGQGASESTGRADTTQPSARMRGGSSIEPPLEDVPG
LGGPGIDSAGPRLMLPNGAVLSAQGLPTGSGREQLERALVVQESERRKKLRFHPRQLYLS
VKQGELQKVVLMLLDSLDPNFQSEQQSKRFPLHAAAQKGYMEICHVLLQAGANINTVDKL
RRTPLMEAVANNHVELAHYLIKRGGCVYTKEDDGSTCLHHAAKNGNVEMVSLLLSTGQVD
VNAQDSGGWTPIIWAAEHKHLEVIRMLLTRGADVTLTDNEENICLHWASFTGRXLNAQCD
LHAVNFHGDTPLHIAARESYHDCVLLFLSRGADTEVRNKEGDSPVDLTLENSEVXFALQL
NRKIRQGILNRSMRTECIISRDVARGYENVPIPCVNSVDDEPCPEDYKYISENCETSTMN
IDRNITHLQHCTCQDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSC
WRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDD
SYLFDLDNKVRFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLEAHQDLLP
DAGGLPATQA
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgccggagcgggagccacgcagggtgagccgtctcggggagccccgggggca
acgtcgctggtggaagtgggagcagatgacacaggtgttatccctttgagagagagttcc
gatccctcctcaggatccttgtctccccggaagaccaaaaccagtttgggaggaacagga
gatagtctaccgaccactggcagaaattgtgatgatggagcgcgaatacagatgaccagc
tgtggtaaagaagctggtgggatgtcacctgagttgggggctgtctcggccggttcaaac
gccagtcccagtccagggaataaaggtctgccgggccatgcagccaaaactttcccatcg
tcccctagcaaagcaggtgggcccagccgagcaaagatgtccctcactggggccagcaaa
tcccccacgtctgttcagagtctagctatgcgcctgctgagtatgcctgggtcacggttg
cctggggatgctgcgactccctccaccgaagcttcaccaccggctccaccgcctgctcca
gctcagactccagccccagcagctgaggaggccaagcccaaggttcaccgggcccggaaa
accatgtctaagcccaacaccgggcaggtccctgagaagagagtttctgaaatgctgcac
ttccgagtcccggatgacctgaggagcatcgaagagccagaagaacctgccaagcgccgg
aagtacgactacatgaccgacgcgatgcacaagagaatgcctctctctctccaccggtca
agtcccagagccaccactgagatcacagtgacggaagagatggctgctcccgccacagcc
tcacaggaggagagaactcaggagtgggagacagaagtgggggatgacttcagcctctac
tatgacagctattctgtggatggccatgttgactcggacagcaaggaggaagatgatgat
gaggatgaagatgaggacgatgaagaatcgggtaacctctctgacaggagtgtcgcctcc
agctccaggcgaaaggccaggaagcgctggcggaatgacagcccctgggtgaagccatcc
cataaacgcaagcgtaaagagccacaccccaaggacaccagaggactgaatggtggccct
tcagccacacagagcgagtacacagaggtgcccctgggttgtctggagctgccgaacgag
gggacactctcccccaacaatgcaggggtgtccaatgagaccagttcgctggagacggag
cgctttgaggagctgcccctctgctcctgccgcatggaagccccaagcatcgaacgcctt
agccagcaggccggaaatcagtgcatggcaacggaaagcgccgacggggagcttagcggc
tgcagcagcagcatcttgaagcgggagacaatgcgtccctcgagccgggttcccctcatg
gtcctgtgtgagacgcatcgagccagaatggtgaaacaccactgctgtccaggttgtggc
tacttctgcactgcgggcaccttcctggaatgccaccctgacttccgggtggctcaccgc
ttccacaaggcctgtgtgtcccagctcaacggcatgatcttctgcccgcattgtggggaa
gacgcttctgaggctcaggagatcactatagccaaggcggacacctccactccagtcccc
gttccaccatcccacgggcagggagcctccgagtctacaggccgagctgacacaacccag
cccagtgctcggatgagagggggttcaagcatagaacccccactggaagatgtgccaggt
cttggcggccccggaattgacagtgccggcccacgtctgatgctgcctaacggggcagtg
ctgtctgctcagggtctccctacaggttctgggcgtgaacaactggagcgtgccctagtg
gtacaggaatctgagcgacgcaagaagctgcgattccaccctcggcagctgtatctctcc
gtcaagcaaggggagctccagaaagtggtactaatgttgttggacagcttggaccccaat
ttccaaagcgaacagcagagcaaacgtttcccactgcatgctgcggcacagaaaggatac
atggagatctgtcacgttttactgcaggccggtgccaacataaacacggtggacaagcta
cgccggacacctctgatggaagctgtcgcgaacaaccatgtggagctagcacactacttg
atcaaaagaggtggttgcgtttacaccaaggaggatgacggctctacatgtctccatcac
gccgcaaagaatgggaacgtcgagatggtcagcttgctgctctccacagggcaagtggat
gttaatgctcaggatagcgggggatggacccccattatctgggctgcggagcataagcac
ctggaggtgatccgcatgctgctcacccgtggggctgacgtcaccttgactgacaacgaa
gagaacatttgcttgcactgggcctccttcacgggaaganngctgaacgcacagtgcgat
ctccatgcggtcaacttccatggagacacgcccctgcacatagctgcccgggagagctac
catgactgtgtcctcctgttcctgtcgcgcggggctgacactgaagtgcggaacaaagaa
ggggactcccctgtggatctgaccttggagaattcagaggtgtgatttgccttgcagctc
aaccgcaagatccgccaaggcatccttaaccgctccatgcgcacagaatgcatcatcagt
agggacgttgcccgtggctacgaaaatgtgcctatcccctgcgtcaactccgtggacgat
gagccatgcccagaggattacaaatacatctcggaaaactgcgagacctccaccatgaac
attgatcgcaacatcacccacttgcagcactgcacgtgccaggacgactgttcctccagc
aactgtctgtgtgggcagctcagcattcgctgttggtacgacaaggacggtcgtttgctg
caggaattcaacaagattgagccgcccctgatcttcgaatgtaatcaggcctgcagctgc
tggaggaactgcaagaaccgcgtggtgcagagcggcatcaaggtccgtttgcagctgtac
cgcacagccaaaatgggatggggtgtcagagcactgcagaccattccccagggaacattt
atatgcgagtacgtgggagagcttatttcggatgcagaagctgatgtgagggaagacgac
tcctacctgttcgatctcgataataaggtgagatttgactacggtgaccgcttctgggac
atcaagagcaagtacttcacatgccagtgtggctcggagaagtgcaaacactcggcggag
gccattgccctggagcagagccgcctggcccgcctggaggcccaccaggacctgttgcca
gatgcgggtggcctccctgccacccaggcttaa

KEGG   Gekko japonicus: 107105569Help
Entry
107105569         CDS       T04299                                 

Gene name
SMYD1
Definition
(RefSeq) SET and MYND domain containing 1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107105569 (SMYD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107105569 (SMYD1)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107105569 (SMYD1)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107105569 (SMYD1)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107105569 (SMYD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12
Motif
Other DBs
NCBI-GeneID: 107105569
NCBI-ProteinID: XP_015261049
LinkDB All DBs
Position
Un
AA seq 486 aa AA seqDB search
METVELFSAEGKGRGLKATKEQWAGDVIFAERAYAAVVFDSLTHLVCHTCFKRHEKLHRC
GQCKFAHYCDRTCQKEGWAKHKSECSAVKKQGKAPNENIRLAAQILWRIEREGGGLTEGS
LVSIDELQNHVEHFGDEEKKELRVDLESFLEFWPPNSKQFGMQYISHILGVINCNGFTLS
DQRGLQAVGVGIFPNLCMVNHDCWPNCSVIFNNGNHEAVRSLFHTQMRIELRALGKISPG
EELTVSYVDFLNVGEDRRQQLKKQYYFDCTCQHCQKGIKDDLMLAVKEGGEKPSQETVKE
IIQYSKDTLEKIDKARSEGVYHEVVKLCRECLAKQEAILGDTNIYLLRILSILSEVLSYL
QHINEAAGCSKRMVDGYVKLYHPNNAQLGMALMRAGVTHWHAGLIEVGHEMLCKAYAVLL
VTHGPSHPITKDLEAMRVQSEMELRMFQQNEFMYYKMREAALQNQKIQVMPEPTNEVSPG
IFQKKQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtggagctcttcagcgcggagggcaaaggccggggcctgaaggccacgaag
gagcagtgggcaggggatgtcatcttcgcagaaagagcttacgcggccgtggtcttcgac
agcctcactcacctcgtctgccacacttgcttcaagcggcacgagaaactccaccgctgc
ggccagtgcaagtttgcccattactgcgatcggacctgccagaaggagggctgggcgaag
cacaagagtgagtgctctgccgtcaagaagcaggggaaggcacccaacgaaaacatccgg
ctggctgcccaaatcttgtggcgaatcgagagagaaggaggagggctgacagagggcagt
ttggtctccatagatgagctgcagaaccacgtggagcattttggcgacgaggagaagaag
gagctgcgggtcgacctggagagcttcctggagttctggccacccaacagcaagcagttc
ggcatgcagtacatttctcacatcctgggtgtgataaactgcaacgggttcaccctgagt
gaccagaggggtctgcaggcggtgggcgttggcatcttccccaacctctgcatggtcaat
cacgactgctggcccaactgttctgtcatcttcaataacggcaatcatgaggctgtaagg
tcattgttccacacccagatgaggatagagctacgggccctgggaaagatctcccccggg
gaagaactgacagtgtcctacgtcgacttcctcaatgtcggtgaagacagaaggcagcag
ctaaagaagcagtactactttgactgcacctgccagcactgccagaaaggaatcaaagat
gacctgatgttggctgtgaaggagggaggggagaagccttcccaggaaacagtgaaagag
attatccagtactccaaggacaccctagagaagattgataaagctcggtcagagggggtt
taccatgaagtggtgaaactgtgccgggagtgtctggcgaagcaggaggccattctggga
gacaccaacatttacctgcttcggatcctcagcatcttgtctgaagttctctcttacctt
cagcacatcaacgaagcggctggctgctccaagcggatggtggacggttacgtgaaactt
tatcaccccaacaatgcgcagctagggatggccctgatgagagcgggagtgacgcactgg
catgctggcctcattgaagtggggcatgagatgctctgcaaggcctacgctgtccttctg
gtgacccacggcccctcccaccccatcaccaaagacctggaggccatgcgtgttcagtcg
gagatggaactgcgcatgttccagcagaatgaatttatgtactacaaaatgagagaagct
gctctgcagaaccaaaaaatccaggtcatgcctgagcccacaaatgaggtttcacccggg
atcttccaaaagaagcaataa

KEGG   Gekko japonicus: 107105838Help
Entry
107105838         CDS       T04299                                 

Gene name
KMT2D
Definition
(RefSeq) lysine methyltransferase 2D
  KO
K09187  [histone H3]-lysine4 N-trimethyltransferase MLL2 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107105838 (KMT2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107105838 (KMT2D)
   03036 Chromosome and associated proteins [BR:gja03036]
    107105838 (KMT2D)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107105838 (KMT2D)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107105838 (KMT2D)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107105838 (KMT2D)
   HMT complexes
    MLL-HCF complex
     107105838 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box PHD_2
Motif
Other DBs
NCBI-GeneID: 107105838
NCBI-ProteinID: XP_015261360
LinkDB All DBs
Position
Un
AA seq 5099 aa AA seqDB search
MDDQKLPGEDKDSGTPANLLAAAADGIVSSEEQGSVEADPPKPPEESPVKEPLEDAEAKE
EPPLTCRSPPKRCAFCNCSKWSLHGQRELLRFDPAPNWAEGLSEPQEGEQPGLREAGNED
QTLIGFADGVSVREVFEPTGHFWAHHWCVVWSAGILRAEGSWLSHVNKAVISGIAQKCEH
CRRLGATIPCRAEGCQRHYHFPCAAASGSFQSMKSLKLLCPEHLDQAVQMEDSRCMVCDA
PGDLRDLLFCTSCGLHYHGTCLEITVTPRKRSGWQCHECKVCQTCRLSGEDSMTLVCEAC
DKCYHTYCLKPAIESLPTDSWKCKSCRVCSDCGFRPSALDPGCQWYENYSLCEGCQEQRC
KDAAGMEAVQRSQENVPPANSPLKNTYPVADTPASPQPMREAHVASPGQTESSSGPVGLH
QEEEGPLECDKKSVDADKPLEMSSVDPEAPAGQEQMEVETTVEPENAPLPAPPPPVPPDP
VSPAHPEEPTLGAKEHPAFELLPVEQEPSESRIEAVPSTQEAEASSPRSPQPASFKAGSP
EAADGEASEEPMDTGTEGLVPGSLGDNRVQAGHEEEEEEAVAPKMELEGRFSPQLSEEET
PEEGHATGGPEPNEAPLSFASESKCSPSPVEAELLGSTSTPLEGYSTGNPLQGGAGGDEA
GPAPPALRPHPLLKSDIVNEISNLSQGDASASSFPGSELPFASPYHEGGGSFSMEMACLT
STDVSLQKDDGASLALGEMDDSLLFDVKGEGEKGRRRSSPGRSRVKQGRSSSFPGRRRPR
GGSHGGRGRGRSRLKSTTSSIETLLADIDSSPSKEDDDDDDDTMQNTVVLFSNTDKFVLM
QDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGKA
SDPSRLLLCDDCDISYHTYCLDPPLNTVPKGGWKCKWCVCCVQCGAVSPGFHCEWQNNYT
HCAPCASLVTCPICHVKYVEDDLLIQCQHCERWMHAVCDNLFTEEEVEQAADEGFDCTSC
QPYIVKPVVSVPPPEIVPVKIKEPEPQYFRFEGVWLTETGMAVLRNLSLSPLHKRRPRKA
TPTTPRPCTLNGEGGLEGADPLGPDEKKDGDVEAEEILKAEGFVEHMECEIKLEAPATPD
REAAADADLSKGLLEDSEEVKKRKRKPYRPGIGGFMVRQRKSHTRLKKGCPVLAEVSREV
TGVEGHPEEGAQLSEIPAEGAPEQGAAEGDEKKSKRRGRKKSKLEDMFPAYLQEAFFGKA
LLDLSRKAVLAAGGVGGEGTAHPPVGQGAPRAKVDCGMLQKGPMDGKEASVQQKGNECVD
GRETAAPENSLKAAEAKPENTGTEEQMVPKNTPDPTGAENPATPPGEGVLSSDLDKIPTE
ELPKMESKDVQQLFKDVLGSAEREQQLNCVGAEPEAGGIRDPNRTQLAQRPFLQGGGVSL
GSLQPAVPMETYSGVCQSPFLDSRERSGFFSPEQCEPESPWASSSAASTPTTPTTEGESD
GLSYNQRSLQRWEKDEELGELSTISPVLYANMNFPNLRQDYPDWSSRCKQIMKLWRKVPA
PDKAPYLQKAKDNRAAHRINKVQKQAESQISKQQTKVEVPRRPDRPALHLRIPPQQGALP
GATQPPPPPPPPPPPPVAATSAARQPVYINNAAALPSGSGVESPSELFLNLPSSAASAQP
PAQVPLHEPYGMASACPPPDPRFPSPSSVPAGFTSSSSSSSSGQSPHLPNPRPTPQSGEF
QPTPPGTPRHRPSTPDPFLKPRCPSGSLENLSVPGSPQQSALMLSPPPFGEQKKGLDIKK
EDAGPGICSPSYGYGDSPAGAHHPTEMKAPDVFKAPLTPRQSQVEPQSPGLGHRPPDSHP
LASSPPSQADLYRQSPFPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRIPASPQS
QSSSQSPLTPRPLSNEAFCQSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQMPDA
GFKPLPVSHNSPAVGGYPAVPPSGEPHPKTSQQPQFARSPGANVFPNAQPQMRFTFPPSE
PIKSSPSHGINSHFAPSKPQSTSYVSSPGFHQAGSPLGPGKGTTDSYTVSPLRPPSVLPQ
QPSQQESTLPYLPRTGMVPPGDKREEGVVGPPNRELQELPASQEGAISNISQTELEKQRQ
RQRLRELLIRQQIQRNNLRQEKESAAAAANNSQASWNPEGSGQTFEQMNRSMTPFPAVQD
KGILGSLGTNSGGNKLPGAVMVQTPYVQEERLARPPPAATPSTMDINGRPSVVAAQPFYP
RGVFQAPSPQQQMWQQQQQQQAVSMRLPTPSRFPQPPPQDLSRQALGGLAPRLTGPGEQL
QASTSTLGAQFIELRHNIQKGVGASGTGPAFVQQNPQVRPRFFLPGNDSTNQALKAAVMP
MQAPVLGTQGMQAPKMSVSISSSPQGAEVSNNHHPHAKAVPQLILPPGNLEMQHAPPRPL
SSSGPKEVTVPPSAIDTPPAAGKNQLGLAGRQLPCEVPVEPDLDDDFDSHKDLEDDDDLA
NLSLDPDVAKGDDDLGNLDNLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHL
RLVESANEKAEREDLLKKEPSVGPYLKDGAPPPILSTFKTHSDMLDSKLVSLPADIKPKI
EEGCLKPSPCQFNTAEKLAVKSEAAEKMAATLAVNIKAGQNLMNPGPGGPGIRLSMTQFH
SNSHTSISDKVLYGTPGRPPLTPSQMTNTNNSVLEKFELDGGSLSLANTQQHSPADDLDK
MESSLVASELPLLIEDLLEHEKKELQKKQQMSAQVPGAPQHLQPHAMLAHPTPPSQPHDG
QLVSPQQQQQQLQLGVVARQQGMVASQQLMQQQQQRLAGPQQSQVLAPHMGVTQNQAHLL
ATQHSIQATHGQQNQQQVLAQKPMPGVQLQPPPQQQQQQQMMGLKPQQLQQQQQLANSFF
PDTDLDKFAAEDIMDPIAKAKMVALKGIKKVMAQGSIGVAPGMSRQQVSLLAQRLSGASA
SSEVQNHIPPGSGGQERSTDPTQAHPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLK
ILEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAKKLKLVTEEQSKIQKQLDQVRKQQK
EHTNLMAEYRNKQQQHQQQTSTVLALSPSQSPRLMTKLSGQLLSAHGLQQGPQGLAGQAS
GLRLPQATTMAVQQGLSFMGQQPQQPPPPQPPGGATSNNFFPSSRLLQERQLQQQRLQLA
QKLQQQNLIGQVSMQPQQQQSLMGQMAMQQQGLMGQVSVQQQQSLMGQVSVQQHQPQSLM
GQVSMQQQPSAISQTGLMGQPPPPPPTPQPSQNLLPKQQGLLNSQPGVMVQQLSPQQQQQ
QQQAMLGHSMLQHPGMMGHQASQRQMLLAPQQHRALGSPQQLTQQAQGMMGHRLLLSQQQ
QPGLLGQQRTLLSQQQQGSITQHPALLGQGIAAEPIQHFAQHGSLNQPLHLSQGMQPGPS
QQGLVVKEQQGGPEGSAMPPQEGADGVQQQVLRPHLVSQDLGGQLQLGTQEPQGMASLGA
PLQEQPSQLMLQQHGEQQKAPAEMGQAQQHLLLGSQGSLQLRMQQQQQQSSLLQQPLRTH
LPMDGSLQQEVSQQHHRDATQGPHLLSQQMEPQGQVQNIMAQQQQQQRIAGQSLEQPSKG
LPGQLPPQQQHHHHHQQHHLHHHQHLQSPAGPPKTPGLMVPQQQQQQSMMVQQSLPQGQS
ILSSPVMGQIRAQLQGVISKNPQLRNLTPQQQQQLQALLMQRHQQNLLQQQQNQALRQAS
PYQGQAQVSLEPCQPAAQQLSLPGAAAQHPQRQSPLAVFQIRPEQSFTASVEQQRVQVSQ
QATSSPQQQGVLRLPTPQASSVPLSIAGVTPTAQQHPSPSEPKRPSPVILAKSPEQQLTP
AEKKQPATPSPLLPPDPAPFAPSTEEIVTGTCGLRDSACPTKDSAEKGPVNGQVVGSASP
PVGGVPAPVGDLLSITIKQEPKEEAAQCALMSSTQPVKHEANGDMVLTAATVPATTNSLA
RSEAGHLLLQKLLRAKNVTLATQRSGDVNGHVDGKVAGVEGRVQAVPDVRADMVAAKKPP
PPKPKRCQKAGERLTNSRKKLRKEDGVKSNEALMKQLKQELSLLPLMEPVITANFNLFCP
FGSSPINGKSQLKGSFGNAALDSIPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKLV
NGVMSTEELTEQRKDPVLPHEPEGQKDAPPVEVKSVDLLAALPTPPHNQTEDVRMESDEE
SDSPDSIVPASSPESVLGEEMPRFPLLAGAKSEMEERPLSPVIPIIPKASIPAFPDNKPY
VALEQVGKGTPGTSWDKAKGSEVSVMLTVSTAAAKNLNGVMVAVAELLSMKIPNSYEVLF
PDSPMRGATSEPRKGEADAQGKEKPVAAKGPESGPEWLKQFDAMLPGYSLKNELDILTLL
KQESPAPEKTAQHCYINNVANLDVRQLLTLPEEPSPPLSPFAPSPPSPPRAAEPAPEPEL
PPLPAQSPPASSPKEEAPQSPLKAKPRSRPLEDNEENKPRVKKWKGVRWKRLRFLITIQK
GGAKRDGDREIAEFVDRLAATLRPEKVPRDMRKCCFCHEEGDGATDGPARLLNLDLDLWV
HLNCALWSTEVYETQGGALINVEVALHRGLLTKCSLCQKTGATNSCNRIRCPNVYHFACA
IRAKCMFFKDKTMLCPLHKLKGPCDQELSTFTVFRRVYIERDEVKQIASIIQRGERLHMF
RVGGLVFHAIGQLLPQQMADFHSVTALYPVGYEATRIYWSLRTNNRRCCYRCTICENNGR
PEFVVQVMEQGLEDLVFTDSSPQAVWNRIIEPVAMMRKEADMLRLFPEYLKGEELFGLTV
HAVLRIAESLPGVESCQNYMFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNST
SMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLKTEWKNNVYLARSRIQGLGLYAAKDLE
KHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCA
PNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 15300 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcagaagctgcctggtgaggacaaagactctggcacgccagctaacttattg
gcagcagcagcagatggaattgtctcctcggaggagcagggcagtgtggaagccgatccg
ccgaagccgccagaagagagccctgtgaaagagcccttggaagacgcagaggctaaagag
gaaccgccactgacctgccgctccccacccaaacgctgtgcgttctgtaactgcagcaag
tggagcttgcacgggcagcgtgagctgttgcgttttgatccagcacccaactgggcagaa
ggtctttccgagcctcaggaaggggagcagcctggcttaagagaagctggaaatgaggac
cagaccctcattggctttgcagatggtgtttcggtgcgagaggtgtttgagccaacaggg
cacttctgggctcatcactggtgtgtggtgtggtcagctggaatcttgcgtgcggaaggg
tcatggttgagccatgtgaacaaagctgtcatctcagggattgcacagaaatgtgaacac
tgtaggagactgggtgctaccattccatgtcgtgcggaggggtgccagcgccactatcac
ttcccctgtgctgcagccagtggctccttccagtccatgaagtcattgaagctcctgtgt
ccggagcacctagaccaggctgtgcagatggaggactcgcgctgcatggtgtgtgatgca
cccggggacttgcgtgatctgctcttctgcaccagctgtggcctgcactatcatggcacc
tgcttggagatcacggtaacgccccgcaaacgctccggctggcagtgtcacgaatgcaaa
gtttgtcaaacgtgtaggctatcgggggaggacagcatgacgttagtgtgtgaagcgtgc
gataaatgttaccacacgtactgcttgaagccagccattgagagcctccccacagactcc
tggaagtgtaagagttgtcgtgtctgctctgactgtggcttccgcccatccgcactggat
cccggctgccagtggtacgagaactactctttgtgtgaagggtgtcaagagcagcgttgc
aaggatgcggctggcatggaggctgtacagcgcagccaagaaaatgttcccccagcaaac
agtcctctgaagaatacgtaccctgtagcagacacgccggcatctccccagccaatgcgg
gaagctcatgtggccagcccagggcaaacagaaagcagcagtggccctgttggcttgcac
caagaagaggagggtccattggaatgtgataagaaatctgttgatgcagacaagccttta
gagatgtccagcgtggatccagaggcccctgcagggcaggagcaaatggaagtggagaca
acagttgagcctgaaaatgcccccttgccagcaccccctcctccggtacctccagatcct
gtctcacctgcccatcctgaggagcccacactaggtgccaaagagcatcctgcctttgag
ttgctgcctgtagagcaggaaccctcagagagccgtattgaggcagtaccatctacccag
gaagctgaggcatcgtctcccagaagccctcagccagcctctttcaaagctggttcccct
gaagctgctgatggagaggccagtgaggagcccatggatacagggactgaggggcttgtt
ccaggtagcctgggtgacaacagagtccaggctggccacgaagaggaagaagaggaggca
gtggcaccgaagatggaacttgagggaagattctccccgcagctgagtgaggaggagact
ccagaagaaggacatgccacaggagggccggagcccaacgaggctcccctcagctttgcc
agtgaatccaagtgctctccctcgccagtggaggcagaattgctgggcagcacatccacc
ccattggagggctacagcaccggcaacccacttcagggaggggcagggggagatgaggcg
ggaccggccccaccagccttgaggccccaccccttgcttaagtcggatattgttaatgag
atctcaaacctgagccagggtgacgccagcgccagcagctttccaggctcggagcttcca
tttgcttccccatatcacgaaggcgggggctcattctccatggaaatggcctgcttgacc
tccacagacgtcagcctgcaaaaggacgatggagcctccttggccctgggcgagatggac
gactctttactctttgatgtaaaaggggagggtgaaaagggccggcggcgcagctccccg
ggccgctcccgtgtcaaacagggtcgcagcagcagttttcccgggaggagaaggcctcgg
ggagggtctcatggcggtcgggggcggggccgctcacggttgaaatccaccacttcttca
attgagacgttgcttgctgatattgacagctccccgagtaaagaggacgacgacgatgac
gacgataccatgcaaaacacagtggtgctcttctccaacaccgacaagtttgtgctgatg
caagacatgtgtgtcgtctgtggtagctttggccgtggcgctgagggacatctcctcgca
tgttctcaatgctctcagtgttaccatccatactgcgtcaatagcaagattaccaaggtg
atgctgctcaagggctggcgttgtgtagaatgcatcgtgtgtgaagtatgcggcaaagca
tccgacccgtctcgtctgttgttgtgcgacgactgtgacatcagctaccacacgtattgc
ctggacccgcccctcaacactgtgcccaagggaggctggaagtgtaaatggtgtgtgtgc
tgtgtgcagtgtggggcagtatcacctggtttccattgtgaatggcagaacaattacacc
cactgcgcgccctgcgccagtcttgtcacctgtcccatttgccatgtgaagtatgtggag
gatgacttattaatccagtgccagcattgtgagcggtggatgcatgcagtgtgtgacaat
cttttcactgaggaagaagtagagcaggcagcagatgaggggtttgactgtacctcgtgt
cagccctatatagtcaagcctgtagtttcagttccccctccagaaattgtcccagtgaag
atcaaggagccagagccccagtattttcgttttgaaggtgtctggctgacagaaactggt
atggctgtgcttcgtaacctgtctttgtcaccattgcacaagcgccggccgcgtaaggca
acaccaacgacaccacggccgtgtaccctcaatggcgaaggtgggctggaaggagctgac
cctctgggcccagatgagaaaaaagacggtgatgtagaggcagaggagatcctgaaagct
gaaggtttcgttgagcacatggagtgtgagatcaaactggaagctccggctaccccagac
agggaagctgctgcagatgccgacttgagcaagggccttctggaggactcggaggaggtc
aagaaacggaagcggaagccataccgccctgggattggagggtttatggtgcggcaacgg
aagtcacacacacgcttgaaaaagggctgcccagttttggcggaagtctctcgtgaggtg
actggtgtggaggggcaccctgaagagggggctcaactttctgagatccctgcagagggt
gctcctgagcagggagcggctgagggtgatgagaagaagagcaagcggcgtggtagaaag
aagagcaagctggaggacatgttccctgcctaccttcaggaagccttctttggaaaagca
cttctggacctgagcagaaaggccgtgttggcagccggtggtgtgggtggagaaggaacg
gctcaccctcctgtcggccagggagctcccagggccaaggtggactgtggcatgctccag
aaagggccaatggatggaaaggaggcctcggttcagcaaaaagggaatgaatgtgttgat
ggcagggagacagctgccccggaaaacagcttgaaagctgctgaggccaagcctgaaaac
accggcacagaagaacagatggtgcccaagaacactccagatcctacaggtgccgagaac
ccagccacacccccgggggagggggtgctcagctccgaccttgacaaaatccccactgaa
gagctacccaaaatggagagcaaggatgttcagcagctctttaaagatgtcctgggatca
gctgagcgagagcagcaactcaactgtgtcggggctgagccagaggctggaggcatccgt
gacccaaaccgcacacagcttgcccaaaggcctttcctgcaaggtggtggggtctccctt
ggatccctgcagcctgctgtacctatggagacctactctggagtttgccagtccccgttt
cttgatagcagggaaaggagtggcttcttcagccctgagcagtgtgaaccggagagccct
tgggccagtagttctgcagcttccacgcccaccacacccacaacagagggggagagtgac
ggactctcctataaccagcggagcctgcagcgctgggagaaggacgaggaactgggggag
ctgtccaccatctcacctgtgctctatgccaacatgaatttccccaacctcagacaggac
tacccagactggtctagccgttgtaagcagatcatgaagctctggagaaaggtgccagcc
ccagacaaagccccttatttgcaaaaggccaaagataaccgggcagctcaccgcatcaac
aaggtgcagaagcaagccgagagccagatcagcaagcagcagaccaaagtagaggtgccg
cggagaccagaccgccctgctctgcatctgcgcatcccaccccagcagggggcactgcca
ggggccacccagccgccaccaccgccgccgcctcctcctcctcctcctgttgctgccacc
tcagcagccaggcagcccgtctacatcaacaatgctgcagctctgccaagcgggtcaggt
gttgagtcgcccagtgagctcttcctcaatcttccctcttctgccgccagtgcccagccc
ccagcgcaagtgcctttgcacgagccctatggcatggcctctgcctgccccccaccagat
ccacgttttccttctccttcctcagtgcctgccggctttacctcctcctcttcctcctcc
tcctccggacagtccccacacctgcccaatccccgtccaaccccacagtctggggagttc
cagcccactccacctggaacccctaggcataggccctccaccccagaccctttcctgaaa
ccccgctgcccgagtgggtctttggaaaacttgtctgtgcctggaagcccccagcaatct
gcactgatgctttcgccacccccctttggggaacagaagaaagggctggatatcaagaaa
gaagatgccgggccaggaatctgctcgccaagctatggctatggtgactcaccagccggt
gctcatcatcccactgaaatgaaagccccagatgtgttcaaagccccgctcaccccccgg
caatctcaggtggagccacagagcccaggtttggggcatcggcccccagattctcaccct
ctggcttcttctccccccagccaggctgatctctaccggcaatctccgttcccggaccct
tatgctcagcctcctctgacgcctcggcctcagcccccacccccagaaagctgctgtgcc
cttccccctcgctcactaccttctgaccccttctcacgcataccagccagcccacagtcc
cagtctagctcccagtcccctctcactccccggccactttccaacgaagccttctgccag
tctccggtcacccctcgttttcagtctcccgacccctactcccggcctccttcacggcca
caatcccgggatccttttgcccctctgcacaagccccctcgtccccagatgccagatgcc
ggcttcaaacccttgccagtctcccacaacagcccagcagttgggggctatccagcagtg
cctccttcgggtgagccccaccccaagactagccagcaaccccagtttgctcgctcccct
ggtgctaatgtctttccaaatgcccagccccaaatgcgcttcactttccctcctagcgag
ccaatcaagagttccccttcccatgggatcaacagccattttgctcctagcaagccccaa
agcacaagctacgtttcctctccggggttccaccaagctgggagcccactagggccaggc
aagggtaccacagactcttacaccgtctccccgctgcgtcctccctcggtcctgccgcag
cagccatctcagcaagagagcaccttgccctacctgccacggacaggaatggtgccccca
ggtgacaagagggaagaaggcgtggtgggcccaccaaacagggaactgcaagaactgcca
gccagccaggagggggcaatcagcaacatcagccagacagaattagagaaacagcgacag
cggcagagactccgtgagttgctcatccgtcagcagatccaaaggaataacttgcggcaa
gaaaaagagagtgctgcagctgccgcaaacaactcccaggcatcctggaaccctgagggc
agtgggcagacctttgaacagatgaatcggagcatgactccatttccagcggtgcaggac
aaaggaatcctaggcagcctgggtaccaactcgggaggcaacaagcttcccggagctgtg
atggtgcagacaccctacgtgcaggaggagcgccttgcccggccaccccctgcagccact
ccttctaccatggatatcaatggcaggccatcagtggtagccgcacaacccttctaccct
cgtggtgtcttccaagccccatcacctcagcagcagatgtggcagcaacagcagcagcag
caggcagtgtctatgcgtctcccgaccccttcgcgcttcccacagccgcccccccaagac
ttaagccgtcaagctctgggtggtcttgccccacgcctgacaggtcccggagagcagctt
caggcttcaaccagcactctaggagcccagttcattgagctaagacacaatatccaaaaa
ggagtgggtgcgagcggaacaggcccagcttttgtccagcagaatccccaggttcgaccc
agattctttctgcctggaaatgacagcactaaccaggctttgaaagctgctgttatgccc
atgcaggcccccgtcctgggaactcaaggcatgcaggctcccaaaatgtcagtctctatt
tcatcctcccctcagggggcagaggtaagcaacaaccatcaccctcatgccaaggctgtg
ccccagttgattctgccccctggaaacttggagatgcaacatgccccaccccgtccactc
tcttcgtctggccccaaagaggtgaccgttcccccatctgccatagacactcctccagct
gctggcaagaaccagttaggtctggctggtaggcagttaccctgtgaagtgccagtggag
ccagatttagacgatgactttgattcccacaaagatctggaggatgacgatgacttggcc
aacttgagtcttgatcctgatgttgccaagggtgatgacgatcttggcaacctggacaat
ctggagaccaatgacccgcacctcgatgacctgctgaatggtgatgaatttgacttgttg
gcctacacggatccagagctggacactggggacaagaaggacatcttcaatgagcatctg
cgtctggtagaatctgccaatgagaaggcagaacgtgaggacctgctgaagaaagagccc
tctgttggaccctacctcaaggatggggcacctccacccatcctttcaaccttcaagacc
cacagtgacatgctggacagcaaactggttagcctgccagctgatataaagcctaagata
gaggagggctgcctgaagccctccccttgccagtttaataccgctgagaagcttgctgtc
aaatctgaggcagctgaaaaaatggctgcaaccttagcagtgaacatcaaggctggccag
aacctcatgaatcctggacccggaggtcctggaatacggcttagcatgacccagttccac
agcaacagccatacttccatctcggataaggtcctgtacggcaccccaggccgcccacca
cttactcccagccagatgaccaacacaaataactcagtcctggaaaagtttgagctagat
ggagggtccttgagcctggctaatacccaacagcactctccagctgacgatctagataag
atggaaagttccttggtggccagtgagctgcctctcctgattgaagacctgctggaacac
gagaagaaggagctgcagaagaagcagcagatgtctgcccaagtgccgggggcaccccag
catctccagccccacgccatgttagctcaccccactccccctagccagcctcatgacggg
cagctggtaagcccccagcagcaacagcagcagctgcagttgggcgttgtggccaggcag
cagggaatggtagccagtcagcagctgatgcagcagcagcagcagcgtttggctggtcct
cagcaaagccaagtattagccccacacatgggagtgactcagaaccaggctcacctgctt
gccacgcagcacagcatccaagcaacacatggtcaacagaaccagcaacaggtcttggct
cagaagcccatgccgggagtccaactgcagccaccaccacagcagcagcagcagcagcag
atgatggggcttaagccccaacagcttcagcagcagcagcagctggcgaacagcttcttc
cctgatacagatctggataagtttgctgcagaggacattatggatcctattgccaaggcc
aagatggtggctttgaagggtatcaagaaggtcatggctcagggcagcattggagtagct
cctggcatgagtcggcaacaggtttccctgctggctcagaggctgtctggagcttcagct
tcatctgaagtgcagaaccacatcccgcctggctctggagggcaggaacggagcaccgac
ccgactcaggctcatccaaaccctcccacttttgctcaaggtgtcatcaatgaagccgat
caacgtcagtacgaagagtggcttttccacacgcagcagctcctgcagatgcagctgaag
attctggaagagcaaataggagtgcaccgcaaatcccgcaaggccctgtgtgccaagcag
cggacagctaaaaaggcaggccgggagttcccggaggccgatgcaaaaaagctcaagttg
gtgactgaggagcaaagcaagatccagaaacagctggatcaggttcggaagcagcagaag
gagcatactaacctcatggctgagtaccgcaacaagcaacagcagcatcagcaacaaacg
tccaccgtcttggccctcagcccctcgcaaagcccccgtctcatgaccaagctctctggc
cagttgctgtccgcacatggtctccaacaggggccacagggcttagcaggccaggccagt
ggcttgcggcttcctcaagccaccaccatggcggtgcagcagggcttgtcgttcatgggg
cagcagccgcagcagccgccgccaccgcagcctcccgggggtgccacctccaacaacttc
tttcccagcagtcgtctcctgcaggagaggcagctgcaacagcagaggttgcagttggcc
cagaagctgcagcagcaaaacctcattggacaagtgtcgatgcagccgcaacagcagcag
agcctcatgggacaaatggccatgcagcagcaaggcctcatgggacaggtctcggtgcag
caacagcaaagcctcatgggtcaggtctcggtacagcagcatcagccgcagagcctcatg
ggacaggtctcgatgcagcaacaacccagcgctatcagccagactggcttgatgggccag
ccccctcctccaccgcccaccccccagcccagccagaacctgctccctaagcagcaagga
ctgctgaacagccagccaggagtcatggtccagcagctctcccctcagcagcagcagcag
cagcagcaggccatgcttgggcactccatgctgcagcacccagggatgatgggtcaccaa
gcttcacagaggcaaatgctcttggctccgcagcagcatcgggcgctgggatctcctcag
cagctgacccagcaggcgcaaggcatgatggggcaccggctgcttttgtcgcagcagcaa
cagccggggctgcttgggcagcagaggactttgctgagtcagcagcagcagggctcgata
acacaacacccggcccttctggggcagggtatagccgcggagcctatccagcactttgcg
cagcacgggtctctgaaccagccgctgcacttgagtcagggaatgcagccgggcccatcg
cagcagggcctggttgtcaaggagcagcagggagggccagaaggcagcgccatgccgcct
caggagggggcagacggcgtgcagcagcaggtgctgcggccccatctggtaagtcaggac
ctgggggggcagttgcagctaggcacccaggagccacaagggatggccagccttggagcc
cctctgcaggagcagccctcccagctgatgcttcagcagcacggggagcagcagaaagct
ccagcagagatgggccaggcgcagcagcaccttctcctgggatctcagggctcgctgcag
ctacgtatgcagcagcagcagcaacaaagcagcctcctgcaacagccactgcggactcac
ctgcccatggatggttccctacagcaagaagtgtctcagcagcaccatcgcgatgcaact
cagggcccccatttgctaagccagcagatggaaccgcaaggtcaggtgcaaaatatcatg
gcccagcagcagcagcagcaacggattgccggtcagagcctggagcagccttccaaaggc
ttgccagggcagcttccgccccagcagcaacaccaccaccaccaccagcagcaccatctc
caccaccatcagcaccttcagagcccagcgggtcctccaaaaacaccagggctgatggtg
ccgcagcagcagcagcagcaaagcatgatggtccagcagtccttgccccagggccaaagc
atcctgtccagcccggtcatgggccagatccgcgcccagctccagggggtcatctccaaa
aacccccagctgcggaatctgactcctcagcaacagcagcagctgcaggctctgctgatg
caacggcaccagcagaacctgctgcagcagcagcagaaccaagcgttgcgacaggccagc
ccttaccaagggcaggcccaggtgtcgcttgagccgtgtcagcccgctgctcagcagttg
tccctgccgggggctgcggcacagcatccgcagagacagtcaccccttgcggtgtttcag
attcgtccagagcaaagtttcactgcctctgtggagcagcagagggtacaggtgagccag
caggcaacgagtagtccccagcagcagggggtgttaagacttcccactcctcaggcttcc
tctgtgcccttgagcattgctggtgtgacccccactgcccagcagcatcctagcccttca
gagccaaagagaccctcccctgtgatcttagctaaaagcccggagcagcagctgaccccc
gctgagaagaaacagcctgctacccccagccccctgcttccccctgacccggcccctttt
gccccaagcacagaggagatcgttacggggacctgcggcctcagggactcagcgtgcccc
accaaagactctgcagagaaaggccctgtcaacgggcaggtggtgggatctgcctctccc
ccagtaggaggagttccagcccctgtgggcgatcttctatccatcaccatcaaacaggaa
cccaaggaggaggcagcgcagtgtgccctgatgagcagcacccagccggtcaagcacgag
gccaatggtgacatggtgttgacggcagccacagttcccgctaccacgaatagcctcgcc
cggtctgaagctggccacctcctgttgcagaagctgctgcgggccaagaacgtgacgctt
gcaacacaacgctcaggggatgtcaatggccacgtggatggcaaagtggccggagtggag
ggccgtgtgcaagcagtcccggatgtaagagcggatatggtagctgcaaagaaaccgcca
cctcccaagcccaagcgatgtcaaaaggctggagagcgacttaccaactcccgcaagaag
ctgcgcaaggaggatggggtgaagtccaatgaagccctaatgaaacaactcaagcaggag
ctctccttgctgcctctgatggagcctgttatcacagccaacttcaaccttttttgcccc
ttcgggagcagccccatcaatggtaaaagccagcttaagggctcttttggtaacgctgcc
ttggacagcattccagactactactcacagctgcttaccaagaacaatttaagcaacccg
ccaacaccgccgtcttcactgccccccacgcctcccccctctgtgcagcagaagctggtg
aatggagttatgtctactgaggaattgactgagcagcgtaaggacccagtactgccccat
gagcctgaaggacaaaaggatgctccccctgtggaagtgaaaagtgttgacctccttgca
gcccttcccacaccccctcacaaccaaactgaggatgtcaggatggagagcgatgaagaa
agcgactcccccgacagcattgtcccagcatcgtctccggagagtgtcctgggagaagag
atgccacgcttccccttgctggctggagccaagtctgagatggaggagcgcccgttgtca
cccgtcattcctatcatcccaaaggccagcatcccagctttcccagataacaagccctat
gtggcactggagcaggtggggaaggggacaccaggcacttcgtgggacaaggccaagggc
agcgaggtctccgtcatgctcaccgtctccacagctgctgctaagaaccttaacggtgtc
atggtggctgttgctgaactgttgagcatgaagatccccaattcttatgaagtgctgttt
ccagacagccccatgcgaggtgctaccagtgagcctcggaaaggtgaagctgatgcacag
ggcaaagagaagccggttgctgcaaagggccctgaaagtggccccgagtggttgaagcag
tttgacgcaatgctgcctggctacagtctcaagaatgagctggacatcttgacgttgctc
aagcaggagagcccagctccagaaaagacggcccaacactgctacattaacaatgtcgcc
aatctggacgtgcggcagctcttgacgctccctgaagagccatctccacctctttcccct
tttgctccttccccacctagtccccccagggcagcggagcctgcccctgaaccagaactg
ccgcctctacctgctcaatctcccccggcttcttcccccaaggaggaagctcctcagtcc
ccactcaaagccaagccacgctcccggcccctggaagacaatgaggagaacaaaccacgg
gtgaagaaatggaaaggagtgcgctggaaacggctgcggttcctgatcaccatccagaag
ggtggtgccaagcgtgacggggacagggaaattgcagaattcgttgaccgcttggccgct
acccttcggcccgagaaggtgccgcgtgacatgaggaaatgctgcttttgccacgaggaa
ggagatggggccactgatggcccagcccgtctcttgaaccttgaccttgacctgtgggtg
catctcaactgtgccctttggtccactgaggtttatgaaacccagggtggggccctcatc
aacgtggaagtggcactgcaccggggcctgctcaccaaatgctcgctttgccagaagact
ggtgccactaacagctgcaaccgcatccgctgccccaacgtctaccactttgcctgtgcc
atccgggccaagtgcatgttctttaaggacaagacgatgctgtgtcctctgcacaagctc
aagggcccctgcgaccaggagctcagcaccttcactgtcttccggcgggtctacattgag
cgtgatgaggtcaagcagattgccagcatcatccagcgtggggagcgcctccacatgttc
cgggtggggggcctggtcttccatgccatagggcagctcctgcctcaacagatggcagac
ttccatagtgtcacagcgctctaccccgtgggttacgaggccacccgcatctattggagc
ctgcggaccaacaaccgccgctgctgctaccgctgcaccatctgcgagaacaatggccga
cctgagtttgtggtgcaagttatggaacaaggtctggaggacttagtcttcacggattcc
tcgccgcaggctgtgtggaatcgcatcatcgaaccagtggccatgatgcgcaaggaagct
gacatgctgcgacttttccccgagtacctaaagggagaagagctctttggcttgacagtg
catgctgtgctgcgcatcgcagaatctttgcctggtgttgagagctgccagaactacatg
tttcgctatgggcggcatccgcttatggagctccccctcatgatcaaccctacaggttgt
gctcgatcagagcccaaaatcctcacacactacaaacggccccacaccctgaacagtacc
agcatgtctaaggcctatcagagcacattcacaggtgaaaccaacacaccatacagcaag
cagtttgtccactccaagtcctcacagtaccgccgcctcaagacagagtggaagaacaat
gtctatctggcacgctcacgtatccaagggctcgggctctatgccgccaaagatctagaa
aagcacacaatggtcattgagtatatcggcaccatcatccgcaatgaggtggctaaccgg
cgtgagaagatctatgaggagcagaaccgagggatctacatgttccgtatcaacaatgag
catgttattgatgctacacttacaggcggccctgccagatacatcaaccactcctgtgca
cccaattgtgtggctgaggttgtgactttcgacaaggaggacaagatcataatcatctca
agtcgccgaatacccaaaggagaggagttaacttatgattaccaatttgactttgaagac
gatcagcacaagatcccgtgccattgtggagcctggaactgcaggaaatggatgaattag

KEGG   Gekko japonicus: 107106223Help
Entry
107106223         CDS       T04299                                 

Gene name
PRDM2
Definition
(RefSeq) PR/SET domain 2
  KO
K11432  [histone H3]-lysine9 N-trimethyltransferase PRDM2 [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107106223 (PRDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107106223 (PRDM2)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107106223 (PRDM2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107106223 (PRDM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_6 SET zf-C2H2_jaz Terminase_GpA zf-C2H2_11 zf-C2HE
Motif
Other DBs
NCBI-GeneID: 107106223
NCBI-ProteinID: XP_015261821
LinkDB All DBs
Position
Un
AA seq 1698 aa AA seqDB search
MYLFRTQQDSRMNQISTEPALSVETLADVPDHVLKGLPEEVKLLPSAVDKTRLGVWATKP
IFKGRKFGPFVGDKKKRSQVKSNVYMWEVYYPNLGWMCVDATDPKKGNWLRYVNWALSGK
EQNLFPLEINRTIYYKTLKPIEPGEELLVWYNGEDNPEIAAAIEEERASNRNKRNSPKAK
KGKKKSHEAKNKGKKATDKNQKTVLDITSADMRDPKEGHKQEDTSPSVSAVLSLEQTAVI
QEMVNQDTLPNLVISSPVSEPHTMTEEEQEAIVCESEVLEEREELEEVEGEEDEDDEEEE
EEEEEQPEEEEEEEEEEDDVNLPKEIPEMETMSLCEDRLESVEEQSSISEESPESSPKKK
PMVKFSKVQEESNGSIQGTFMYPCQHCERKFTTKQGLERHMHIHISAISHAFKCRYCGKA
FGTQINRRRHERRHEAGPRRKSFPTLGSALISDGGAKSQVIAEDGGVKEEINTKQDLTSL
DNSKMSQETSNSVLLEEIREPKEMHPCKYCRKVFGTHTNMRRHQRRVHERHLIPKGVRRK
PEEPQVPAEQSQQAQNVYVASTDLEEETEADDVYIMDVSSNISENLNYYIDGKIQSNSST
SNCEVIEVESSSAELYGINCLLSPVTVEISSSVKATQTHLTDVPKESPVGSNSEPKKRRT
TSPPLLSKIKTEMDPEPITSLCSITIPLTISTADSLSFPKEKSIYLSSKLKQLLQTQDSS
KVAPSPPSSSSTEIPKLGLPAASPPLLPTASSRFKRRTSSPPSSPQHSPSLRDYGKVGEG
KSLWNDAVLGSKMPKVESHSNSPAWSLSGRDEKETMSPLCLEEYKASKDWTANPPFGNVC
NQQPLDLSSSVKQRSNSKNRAQVPWESVLDLSVHKKPSADAEPKDSKEVNVIQPTCSSVK
KKPTTSMLQKVLLNEYNGTDSASEHSAAEKNASQSVGKSTEVHPEPELHAAVHVPASELG
SGSPSPEKSVPPAATVSSCQLPPLLTPTNSPSPPPCPPMLKVPTPPPPLLPTVPSPLAEE
HVSVTPSSCPSPLSNATAQSPLPILSPTVSASPVPSVEPLSCGSPGPPNLSSSSSSSSFS
SSSSSPSSSSSSSPSPPPLFAVSSVLSPGDNTENSVPIMSFKQEDMDNELQKPREDSHSS
NETDLIQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEDWPFKCEFCVQLFRDKTDLSEH
RFLLHGVGNIFVCSICKKEFAFLCNLQQHQRDLHPDKECTHHEFESGTLRPQNFTDPSKA
NIEHMQSLPDESAEPTKEEEEDEELNDSSEELYTTIKVMAAGVKSKDPDVRMGLNQHYPS
FKPPPFQYHHRNPNGIGVTATNFTTHNIPQTFTTAIRCTKCGKSVDNMPELHKHILACAS
ASDKKRYTPKKNPVPLKQTVRPKNGVVLPGPASNSFRRMGQPKKLNFSVEMSRMSSNKLK
ISALKKKNQLVQKAILQKKKSQQKAELRNSTVESSTHICPYCNREFTYIGSLNKHASYSC
PKKPISPPSKKNTKKKSAVSSPGSDKSGNQRRRTADAEIKMQNTQAHLGKTRARSSGPMP
IQLPSATFRLKQNVKFMPPIRSKKLGVDTXRTASPVRVAKATPAEGKRPKGISKNSSSGL
SSKASRKLHVRIQRNKVSLASKSSSSKKKPDRFSVKSRERTGGPVTRSLQQATSADSPES
KKEETSTKQELKDFRNLL
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttttcagaacacaacaggattccagaatgaatcagatctcaacagagcctgca
ctatcagttgagacgttggctgatgtacctgatcacgtgctcaaaggacttcctgaggaa
gtgaagcttcttccctctgctgttgacaagacacggctcggtgtctgggcaacaaagcca
attttcaaaggcagaaagtttggaccttttgttggtgacaagaagaaaagatctcaagtt
aagagcaatgtgtacatgtgggaggtctactacccaaacttgggatggatgtgtgttgat
gctacagatcccaagaagggaaactggctccggtatgtaaactgggcgctttccggaaag
gagcagaatctcttccctttggagatcaacagaaccatttactacaaaaccttaaagcca
attgagcctggcgaagagctgctggtgtggtacaatggggaagacaacccggagatagca
gctgctattgaagaagagagggccagcaaccgaaacaagaggaactctccaaaagcaaag
aaagggaagaaaaaatcccacgaggcaaaaaacaaaggaaagaaagccacagacaaaaac
cagaagactgttttggatattacttctgcagatatgagagaccctaaagaaggccataaa
caggaagatacaagcccttctgtttcagccgtgctttcactggaacagactgctgtgatc
caggagatggtaaatcaagacacacttccaaacttggtcatctccagtcctgtcagtgag
ccccatacaatgacagaagaggaacaagaagcaatagtatgtgaatcagaagttctggag
gagagagaagagcttgaggaagtggagggagaggaagatgaagatgatgaggaagaagaa
gaggaagaggaggagcagccagaggaggaggaggaggaagaagaagaagaagatgatgta
aatttgcctaaagaaatccctgagatggagaccatgtctttgtgtgaagacagactcgaa
tctgtggaagagcagagcagcatatctgaagaatctccagaaagctcccccaagaaaaag
cccatggtgaaattttccaaagtccaggaggaatccaacggcagtatccagggaacgttt
atgtacccttgtcaacactgtgaaagaaaattcacaacaaagcaaggactcgaacgccac
atgcacatacacatatcagccattagtcatgctttcaaatgccgctattgtggcaaagcc
tttggcacacagatcaaccggcgaaggcatgagcgacgtcatgaggctgggccaagaagg
aagtcattcccaacacttggttcagctctgatttctgatggtggtgctaaaagccaagtg
attgcagaagatggtggtgtaaaagaggaaattaacaccaagcaagacttgacgtccttg
gataacagtaaaatgtctcaagaaacatcaaactccgttcttcttgaagagatcagggaa
cccaaagaaatgcacccatgcaaatattgtaggaaggtttttggaacccatactaatatg
cgcaggcaccagcggcgggttcatgagcgtcatctgatccccaaaggtgtccgaagaaaa
ccagaagagccacaagttccagcagaacaaagccagcaagctcagaatgtgtatgtagcc
agcacagatctcgaggaggagacagaggctgatgatgtatacattatggatgtttccagc
aatatatctgaaaatctcaattactatattgatggtaagatccagtccaacagtagcaca
agcaattgtgaagtgatcgaggtggaatccagctctgcagaactctatggaataaactgt
ttactcagtcccgtgacggtggaaatctcctcaagcgtgaaggctacgcaaacccatctg
accgatgtaccaaaagagtctccagtcggtagtaacagtgagcctaaaaagaggaggacc
acaagtccccctctcctctcgaagataaaaacggaaatggatcctgagccaataacgtca
ctctgctcaataacaattcctcttaccatatcaacagctgacagcttgtcttttcccaaa
gagaaaagtatttacttatcatcaaagctgaagcaacttctccagactcaggacagtagt
aaggtagctccgtcgcctccatcatcatcgtcaacagaaatccccaagttgggacttccg
gctgcatctccacctcttctgcccacagcttcaagcaggttcaaaaggagaaccagttcc
cctcccagttctccacagcacagtccatctctacgggactatggcaaagtgggtgagggg
aaatccctttggaatgatgcagtactaggatcaaaaatgcccaaggtagaaagtcatagc
aattctcctgcatggagtttgtcaggtagagatgaaaaggagaccatgagccctctttgt
ttagaagaatataaagcatcgaaagactggacagccaatcctccctttggcaatgtgtgc
aaccagcagcctttggatttatccagcagcgtcaagcaaagatcaaattccaagaacagg
gcccaggttccttgggagtcagtgttagatctcagcgtacataaaaagccttctgctgat
gctgaacccaaggacagcaaggaggttaatgtgatacagccaacatgtagtagcgttaag
aagaagccaaccacatccatgttacagaaagttttgctgaacgaatacaatgggactgat
tcggcctcagaacattcagcggctgaaaagaatgcaagccagagtgtaggcaaatccacc
gaagttcatccagagcctgagcttcatgctgcagtccatgtgccagcttctgagttggga
tctggtagcccttcccctgagaaatctgtacctccagcagctactgtctcttcatgtcag
cttcctcctctcctgaccccaacaaattctccttccccaccaccctgcccccctatgtta
aaggttcccactccaccccctcctctgcttcctactgtcccatcaccacttgcggaagaa
catgttagtgtcactcctagttcatgtccctctcccctgtccaatgctactgctcagtcc
cctctcccgatcctttctcctacggtctcagcatcaccagttccctctgtagaacctctt
agctgtggttcaccaggccctcccaatctctcctcatcatcctcttcttcctccttttca
tcctcttcctcctccccttcttcttcctcttcttcttctccttctccacctcccctgttt
gcggtttcttcagtcctttcccctggtgataacacagaaaactcagtccccatcatgtca
tttaaacaagaagacatggacaacgagcttcaaaagcccagggaagactcacacagttcc
aacgaaacagatctcattcaggaaacatttaacaagaactttgtgtgcaatgtctgtgag
tctcccttcctttccattaaagatctaactaaacatctctccattcatgctgaggattgg
cccttcaaatgtgaattctgcgtacagctttttagggataaaacagacttgtccgaacat
cgtttcttgctccacggagttgggaacatttttgtttgctccatctgcaagaaggagttt
gcctttttatgcaatttgcaacagcaccaacgagatctacaccccgacaaagaatgcacc
caccatgaatttgaaagtgggactctacggccgcaaaactttacagaccctagtaaggcc
aacattgaacatatgcagagcctgccagatgaatccgctgaaccaactaaggaggaggag
gaagacgaagaactcaatgactcttccgaagagctgtataccaccatcaaagtaatggct
gcaggggtcaagtctaaagatcctgatgtccgtatgggactcaatcagcactacccaagt
tttaagccccctccattccaatatcaccaccgcaatcctaatgggattggagttactgcc
accaacttcaccactcataatatcccgcaaactttcaccactgccatccgctgcacaaag
tgtgggaaaagcgtggacaacatgcctgaattgcacaaacatatcttagcgtgtgcttct
gccagtgacaagaaacggtatacacctaaaaagaatcctgtgccattaaaacagacagta
cgccccaaaaatggggttgtccttccgggtcctgcaagcaactctttcaggcgcatggga
cagcccaagaaactcaatttcagtgttgaaatgagcaggatgtcctctaacaaacttaaa
ataagcgcactgaagaagaagaaccaactggtccagaaagcaatattgcagaaaaagaag
tctcagcagaaggcagagctgaggaacagcacggtagagtccagcactcacatctgcccc
tattgcaacagagaattcacgtacattggaagtttgaacaagcacgcttcctatagctgt
cccaagaaacccatttccccaccttctaaaaagaacactaaaaagaagagtgccgtttcc
tctcctggcagcgacaaaagtggaaaccagcgacgacggacagcagatgccgagatcaaa
atgcaaaacacacaggctcacttgggcaagaccagagctcggagctctggacccatgccc
attcagctgccctcggcaaccttcagactgaagcaaaatgtcaaattcatgccacccatt
cgatccaaaaagctgggcgtggacaccnncaggactgccagccccgtgagagtggccaaa
gcaactccagcggagggcaaaagaccgaaggggatctcgaaaaacagttcctccggactc
tcgagcaaagcatcccgcaaactgcatgtccgaatacaacggaacaaagtgtccctggcc
agcaagtcgtcatccagcaaaaaaaagcctgatcggtttagcgtgaagtcgagagagagg
actggaggccccgtcacccggagcctgcagcaggcaaccagtgctgattccccagaaagc
aagaaggaagaaactagcacaaagcaggagttaaaagatttcaggaaccttctgtag

KEGG   Gekko japonicus: 107106655Help
Entry
107106655         CDS       T04299                                 

Gene name
SETD1A
Definition
(RefSeq) SET domain containing 1A
  KO
K11422  [histone H3]-lysine4 N-trimethyltransferase SETD1 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107106655 (SETD1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107106655 (SETD1A)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107106655 (SETD1A)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107106655 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     107106655 (SETD1A)
    COMPASS/SET1 complex (yeast)
     107106655 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 Topoisom_I_N
Motif
Other DBs
NCBI-GeneID: 107106655
NCBI-ProteinID: XP_015262320
LinkDB All DBs
Position
Un
AA seq 1899 aa AA seqDB search
MDQEGGGDFQKTPNFQWRNYKLVVDPVLKRAPHKIYRYDGVHFSSNDSGFAPVGDLRDPR
HRIWSKNRDLSLPVPKFKLDEFYVGQIPLKEVTFARLNDNIKEPFLAEMCKKYGDIEEIE
ILYNPKNRKHLGLAKVLFTSTRGAKETVKNLHNTSVMGNIIHAQLDIKGQQRMKYYELIV
NGSYTPQTVPTGGKMLNEKFPADSSESRRRHSTDSYLGNAMPSTPGNGTPCSQDTPYSSG
RQDTPSSYGQYTPQSSQGTPYTPRGGTPYSQDSAYSSRQGTPAYSTYQPESTSYKSRRHE
NSFPDSYSRRHYSSSSSSSSSSSSSSSSHYRSNDHHYPPFSQQFDGGTAAPVSNRYQRHS
SASEGRSSSASSHRSHQREDSGFQSRHRERTQRDDPAPSSTTVITTAAASTTTTATTTSS
SSSSSSAATASDSAQFQNSHTFAQQSAEHFPAPSVLYPTYAATPEPFSLPSESHPVDQDY
RLLPTAETFAANSLPPTEFLAQESKENISPAVTTALGIDDQSHSPATQTSPARSGSPAPE
TTNESVPFAQHSSLDSRIEMLLKEQRSKFSFLNSDTEEEEEEKGGPPKGAEPHGPCTPPP
PLPVSFEDVVPGLDMASGAESPKANGQDRASQQSSGEDMEISDDEAEVEPPAPMAGVSEP
HFSVMPSALGHLPLVSSFTPHHRPEPPLPPSAYSLQPLMSVTLPHLAAKTHSLSTYGQVG
PRLAHRLSDFRGRAGVVSGGRGAPHIYDFVNSMELMNRLGNQWGGMPMSFQMQTQMLSRL
QQLRQSKGQFEDPFSYHREAASFCGRPLYGHGYLMDQGGHHFQRDQLFMQQPPAAVGASE
QQPQQQHSSEQPPLPPPQRLLDFRSGQWGYQEEAAPPPPLPKDPHASVVDSVLATLMQEM
KNIMQRDLNRKMVENVAFSTFDKWWERKEEKAKPFQSTAKQPVKEEEKEKTKLKDPALLS
LVDWAKSGGTGGGLEGFGFGTGFRGVLRLPSFKVKRKEPSEISDDSEVKEPRPSTPAEED
EEDKQPSQIPKVSKRDDERIKGPGKRRKLFCLDSEGEEASEDSSSEKEEEEERRREEEEG
GGRERGTKGAESDADSDASSKYSLFDESDEDSDSTSDSESSSSSSSSSSSSSSSDEEEAE
SMEDMDEPATDSCPAKPPLGPEERAQQAADAELVKKKPEAGGIQGHIAEEKPAPLEESRP
VPPPEEKNAGILSRPEERPSSPIPLLPPPKKRRKTVSFSTPGEDDSTKGVLEKLPDLAPA
ALLPPPPPAPTEEAQLPLVSVEPTLPPQVSLTSDTPPPAAFSLPPTPFPARPMVAPSRKR
EPPKASQRTISNLPADHASLVKCWSDELLPGGXNRSRYRSSEAPRVLPPPEEDRLRMRER
MGASSLLELANQPNLSVLADVALKMPVGAVSEDSEATETSDEAEESKAPRPPAPSIEVSS
ILLEHNYAMAVRVAPVTVPRKPEEAPVLGSADLLRVDLYSEPLGEVLEAPEEVVADASEV
KAEPEVGDLVALPPPPSLPAEKPKATVLEQQQAKKQHPHLFKEEVMKDLGPLPFGPEDLF
PSESEEDEEEEEEESADSSDEGEIRRRSLRSHSHKRVPAQPPLPPPVFETRSEFEQMTIL
YDIWNSGLDLEDMKYLRLTYERLLHEDNSTDWLNDTHWVHHTITNIANPKRKRKSSDLRE
HQTGCARSEGYYHISKKEKDKYLDICPATVQQLEPADIQGTNRILSERRSEQRRLLSAIG
SSAILDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVAD
MREKRYAQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVI
YSKQPIGVNEEITYDYKFPIEENKIPCLCGTENCRGTLN
NT seq 5700 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagaaggtgggggtgacttccaaaaaacccctaatttccagtggcgaaactac
aagcttgttgttgacccagtgctcaagcgggccccccacaagatctatcgctatgatgga
gtgcacttcagctccaatgattcgggctttgctcctgtgggtgacctgcgggatcccagg
caccggatatggtccaaaaacagagacctttccctccctgtcccaaagtttaagctggat
gaattctacgtgggccagatccctctgaaggaggtgacctttgcccggctcaatgacaac
atcaaggagcccttcctggccgagatgtgcaaaaaatacggtgacattgaggagattgag
atcctttataaccccaagaaccgcaagcacctgggcctggccaaggtgctcttcaccagc
acaaggggggcgaaggaaacggtcaagaacctgcacaacacttcggtcatgggcaacatc
atccatgcccagctggacatcaaaggtcagcagcgaatgaagtactatgagctgattgtg
aatggctcctatacgcctcagactgtccccactgggggcaaaatgctgaacgagaaattc
ccagcagactcgtcggagtcgcgaaggcgccactcaactgactcctaccttggcaatgca
atgccttcaacgcccggcaatggcacgccctgctctcaggacacgccgtattccagcgga
cggcaagacacgccctcttcctacggtcagtacacgccgcagtcgtcccagggaacaccg
tacacccctcggggagggacaccatattcccaggattctgcctactccagcaggcaaggg
acgccagcctactctacttaccagccagagtcaacatcgtacaagtcccgccggcacgag
aacagttttccggactcctactcccggcggcattattcttcttcatcgtcttcctcctct
tcgtcctcctcctcctcgtcttctcactaccgcagcaatgaccatcactacccgcccttc
agtcaacagttcgatgggggcaccgctgccccagtcagcaaccggtaccagcgccattca
tccgcttcggaagggcgctcctcctccgcctcctctcaccgctcccaccaaagagaggac
tctggcttccagtcccgacacagagagcgcacccagcgggacgatcctgccccttcctcc
accaccgtcattaccaccgcggccgcctccaccaccaccaccgccaccaccacctcctct
tcctcctcttcttcatctgcggcgacagcatcagacagtgctcagtttcagaacagtcac
acttttgctcagcagagcgccgagcatttcccagcaccgagtgtgctctacccaacttac
gcagccactccagagcccttctctttaccttccgaatcccaccccgtggaccaggattac
cggctgctccccacggcggagacttttgctgccaattccttgcctcccacagaatttctt
gctcaggaatctaaggagaacatcagccccgcggtgacgacagctctgggaattgacgat
cagtcccactctcctgccacgcagacctcgccggcccggtcgggctctccagcccccgag
acgaccaacgagagcgtcccttttgcccagcacagcagcttggactcccgcattgagatg
ctgctgaaggagcagaggtccaagttctctttcctaaattcagacacggaagaggaagag
gaggagaaaggaggcccccccaagggggcggagccacatgggccctgtactccaccgcca
ccccttccagtcagttttgaggatgtggtgcccgggctggacatggcttccggagctgaa
tcccccaaagcgaatgggcaagacagggcatctcagcagtcatcaggcgaagacatggaa
atctcagacgatgaagcagaggtggagcccccagcccccatggcaggagtatctgaaccc
catttttctgtgatgccctcagccctgggccacttaccactggtgtcctcttttaccccc
caccaccggccagagccgccgctgccaccttctgcctactctctacagcctctcatgtcc
gtcacccttccccatctggcggctaaaacccactcgctgtctacctacggccaggttggg
ccacgactcgcacaccgcctgtcggacttcagagggcgggcgggcgtggtcagtgggggc
cgaggcgccccccacatctatgacttcgtgaactccatggaactgatgaaccgcctgggc
aaccagtggggagggatgcccatgtccttccagatgcagacgcagatgctgagccgcctg
cagcagctccgtcagagcaaaggccagttcgaggaccctttctcctaccaccgggaggcg
gcttccttctgcggccggcctctttacgggcacggctacctaatggaccaggggggccac
cacttccagagagaccagctgttcatgcagcagccgcccgccgccgtgggtgcttcagag
cagcagccgcagcagcagcattcctcagagcagccccctctgcccccaccacagcgcctc
ctggatttccgatcgggtcagtgggggtaccaggaggaagcagcgccacccccgcctctc
ccgaaggacccgcatgcctcagtggtggacagcgtcctcgccacactcatgcaggagatg
aagaacatcatgcagcgtgacctcaatcgcaagatggtggagaacgtggctttcagcact
ttcgacaagtggtgggaacgcaaggaggagaaggccaagcctttccagagtaccgctaag
cagcctgtcaaggaggaggagaaggagaaaacgaagctgaaagacccggccctgctgtcc
ctggttgactgggccaagagcggagggaccggtggtggcctagaggggtttggctttggg
accggcttccgcggagttctccggctcccatcattcaaggtgaaaaggaaagagccctct
gaaatctcagatgacagtgaagtgaaggagccccgcccatctactcctgccgaagaggat
gaggaggataagcagccctcacagatacccaaagtgtccaagagggacgatgagcggatc
aagggcccgggaaaacggcggaaactcttctgcctggacagcgaaggggaggaggcatct
gaggactcgtcttctgagaaggaggaagaggaggaacggcgaagggaagaagaggaaggt
ggtggcagagaacgtggcacgaagggcgcggaatcagacgcggacagtgatgcttcctcc
aagtattcccttttcgacgagtccgatgaggacagcgacagcacttctgactccgagagc
agctcttcctcctcctcttcctcgtcgtcgtcctcttcctcagatgaggaggaggctgag
agtatggaggacatggatgaaccggccacggacagctgtcctgccaagccaccactgggc
ccagaagaaagagcacagcaagctgctgatgccgagctggtgaagaagaaaccagaagcg
ggggggatccaaggccatatagcagaggagaaacctgctcctctggaggagagcagacca
gtcccaccaccagaggagaagaatgcgggaatactgtctaggccagaagagcgaccttcc
tcgcctatcccactcctgccgccccccaagaaacgccggaaaacggtctccttctctact
cccggcgaggacgactccacgaaaggggtcttggagaagctgcctgacctggcccccgca
gctcttctgccccctccccctcccgcccccacagaggaagcacaactcccattggtgtct
gtggaacccacactaccaccccaagtgtccttaacctcggataccccgcctccggctgcc
ttctccctgcctcccacgccgttccccgccaggccgatggtggctcccagccggaagcgg
gagcccccgaaagccagccaaagaacaatcagcaacctgcccgctgaccacgcctccctg
gtgaaatgctggtcggacgagctgctgccgggcgggncgaaccgctctcgttatcgcagc
tcggaggccccgcgggtcctgccgcccccggaagaggacaggctgcgcatgcgtgaacgg
atgggcgcttcctcactgctcgagctggcgaaccaaccgaacctgtccgtgttggcagac
gtggctctcaagatgcccgtcggcgcagtcagcgaggactctgaggcgacggagacctcc
gatgaggccgaggagtccaaggccccgcggcctccggcaccgtccattgaagtcagcagc
attctcttggagcataactacgccatggctgtccgtgtggcaccggtgaccgttccccgc
aagccagaggaggcgcccgtgctgggctccgccgacctgttgcgggtggatttgtacagt
gagcccctgggggaggtcttggaggctccggaggaggtggtggcagatgccagcgaggtc
aaagctgagccagaggttggggacctggttgcgctgcccccgccaccttccctgccagct
gagaagccaaaggcaactgtcctggagcagcagcaggccaaaaagcagcatccccacctg
ttcaaggaagaggtcatgaaagacttggggcccttgccttttgggcctgaggatctgttc
ccttcagagagcgaggaggatgaagaggaggaggaggaggaaagtgccgacagcagcgac
gaaggggagatccgcaggagatccctccgctcccactcgcacaagcgtgtccccgcccag
ccccctcttccgcctcccgtctttgagacgcggagcgagttcgagcaaatgaccatcttg
tatgacatctggaattcggggctggatctggaggacatgaagtacctgcggctgacctac
gagcgcctgctgcacgaggacaacagcaccgactggctgaatgacacccactgggtccac
cacactatcacaaacattgcaaaccccaagcggaaacggaagtcatcggacctgcgggag
caccaaaccggctgtgcgcgcagcgaggggtattaccacatcagcaagaaggagaaggac
aaataccttgacatttgcccggctactgtgcagcagctggagcctgctgatatacagggc
actaaccgcatcctgtcggagcggcggtccgagcaacggcgtctgctgagtgccatcggc
tcttctgccatccttgatagcgaccttctgaagctgaaccaactgaagttccgcaagaag
aaactacggtttggccggagtcggattcacgagtggggcctctttgccatggagccaata
gctgctgatgagatggtcatcgagtacgtgggtcagaatatccggcagatggtggctgac
atgcgtgagaagcggtatgcccaggagggcattgggagcagctacctcttccgcgtggac
cacgacacaatcatcgacgccaccaagtgcggcaacctcgcccgcttcatcaaccactgc
tgcacgcccaattgctatgccaaagtcatcaccatcgagtcccagaagaagatcgtcatt
tactccaaacagcccatcggcgtcaacgaggagatcacttacgactacaagttcccgatc
gaggagaacaagattccctgcctttgcggcacagagaattgccggggcaccctgaactga

KEGG   Gekko japonicus: 107106688Help
Entry
107106688         CDS       T04299                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3-like
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107106688
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107106688
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107106688
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107106688
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107106688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TPR_12 Myb_DNA-bind_5
Motif
Other DBs
NCBI-GeneID: 107106688
NCBI-ProteinID: XP_015262358
LinkDB All DBs
Position
Un
AA seq 274 aa AA seqDB search
MAPTKKDEKEKQVKPKLPVTCNCFSISNGEVQDVGVGLYPSMSLLNNSCDPNCVIVFEGP
QLYLHSIREIQIGEELTISYIDTMMPSTERQQQLKRQYCFECDCLMCSTHSKDAVMLAGD
EQAWKEVKEAINKMTTPKSQQEWKQALVKYQTLLKNTSTLLPDTNIYQLKLLDLAMDACI
NLSLLEEALLYGNRTLEPYRFYYSGFHPLRAVQLMRVAKLQYSQDMFPQALETLKQAYDI
MTVTHGAEHSLVQNLMMLKEDCEAGITAKSGLQT
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccacgaagaaggatgagaaggaaaaacaagttaaaccaaaacttcctgtgacc
tgtaactgcttcagcattagtaatggagaggtgcaggatgttggtgttggcctttatccc
agcatgtctttgctgaacaacagttgtgatccaaactgtgtaatagtcttcgagggtccg
cagctctaccttcactcaatccgggagattcagataggtgaagagctcaccatcagctat
attgacacaatgatgcccagcactgaacgtcagcaacaactgaagcgtcaatattgtttt
gaatgtgactgtcttatgtgctccacacatagcaaggatgctgtcatgttggcaggtgac
gagcaagcttggaaagaagtcaaggaagctataaataaaatgacaactcccaagtcacaa
caagaatggaagcaggctctggtgaaataccagacattgttaaagaacaccagtactctt
ctcccagacacaaatatctaccagctgaaactacttgaccttgccatggatgcctgcata
aaccttagtcttttggaggaagctttgctttatggcaacagaactttggagccctacagg
ttttattattctggattccatcctttgagagctgtccagctgatgcgagtggccaaattg
cagtacagccaggacatgtttcctcaggctctggaaaccttgaagcaggcttacgacatc
atgacagtgactcatggggcagagcacagcttagtgcaaaacttgatgatgcttaaggaa
gactgtgaggctggcataacagcaaagagtggcctacagacctga

KEGG   Gekko japonicus: 107108065Help
Entry
107108065         CDS       T04299                                 

Gene name
SMYD3
Definition
(RefSeq) SET and MYND domain containing 3
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107108065 (SMYD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107108065 (SMYD3)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107108065 (SMYD3)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107108065 (SMYD3)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107108065 (SMYD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-MYND
Motif
Other DBs
NCBI-GeneID: 107108065
NCBI-ProteinID: XP_015263934
LinkDB All DBs
Position
Un
AA seq 172 aa AA seqDB search
MEKFASPGKGNGLRLSKHAKPGELLYRAEPFAYTVTKKRLGGVCEHCLRRKDRLLRCSQC
KIARYCNIQCQKEAWQDHKRECKCIKNIDPNFPPDSVRLVGRIIFKLLRQSTCPSEELYS
FCDLQSNFEKLTEEMQEGLGCLTRALQLYLKVEIQDTSQLPPGIDVLQTFAK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggagaagttcgccagtccgggcaaaggcaacggtctgcgcctctccaaacacgcgaag
cccggcgagttgctataccgtgcggaacctttcgcctacaccgtcaccaagaagcgcctg
ggaggcgtgtgcgagcactgcctgcgcaggaaagaccgactgcttaggtgttctcagtgc
aaaattgcaagatactgcaatatacaatgtcagaaagaagcatggcaagatcataaacga
gaatgcaagtgcattaagaatattgatcccaactttcccccagattcagtgaggcttgtt
ggcaggattattttcaaactactaagacaatcaacatgcccatctgaggagctttactct
ttttgtgatcttcagtcaaattttgaaaagttaactgaagaaatgcaagaaggtcttggg
tgtctcacaagggcactgcagctgtatttgaaggtggagatccaagatacttctcagctg
ccacctggcatagatgttttgcagaccttcgcaaaa

KEGG   Gekko japonicus: 107108169Help
Entry
107108169         CDS       T04299                                 

Gene name
KMT2B
Definition
(RefSeq) lysine methyltransferase 2B
  KO
K14959  [histone H3]-lysine4 N-trimethyltransferase MLL4 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107108169 (KMT2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107108169 (KMT2B)
   03036 Chromosome and associated proteins [BR:gja03036]
    107108169 (KMT2B)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107108169 (KMT2B)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107108169 (KMT2B)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107108169 (KMT2B)
   HMT complexes
    MLL3/MLL4 complex
     107108169 (KMT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET FYRN PHD zf-HC5HC2H zf-HC5HC2H_2 PHD_2 RAG2_PHD
Motif
Other DBs
NCBI-GeneID: 107108169
NCBI-ProteinID: XP_015264056
LinkDB All DBs
Position
Un
AA seq 1693 aa AA seqDB search
RTVVKPIVPWDSEDSQEEFPAPWEVILGATETAEQDSLLQRKSARRCVKQRPSYDIFESS
DSDAEPVSGSATHRRKSSRDSDKDPLHTLLGDWRQLDGKEMLVDPSFSPPFPPPPMDSEE
QSRPRRTPLQPVVQLKARKRPEKDVSSSGTLPSISNGWNGKQKSTDGVHRLRVDFKLVFC
QVCCDPFHIFCLEEDEQPLPEQEESWCCRRCKFCHVCGRKNKASKQLLECERCRNCYHLA
CLGPNYPTKPFRKRKGWICSACIRCKSCGTAPGKNWDTEWSSDYSLCSACSVLYDKGNYC
PICLHCYEDNDYESKMMQCAKCDHWVHAKCEGLSDEGYEILSNLPERVCCPDDGVKVHLR
TCDLRTVGKLFEQGHYSSVHSFHEDMVGVLLGHMEEGQAGLNAKAFYIELMGKFFSWFDA
QDPKHWTRNSILPNGMLPNAVLPPSSDHIYAQWKQPEELSPGANSHLTPTGPEKTAGKDA
EQALAQQEFADPEDKRQCALCLQYGDAPSKDAGRLLYIGQNEWTHVNCAIWSAEVFEEND
GSLKNVHAAVARGRQMRCEHCQRTGATVGCCLSACLSNYHFMCARLRHCTFQDDKKVFCQ
KHVDLLDGTEIVAEDGFDVLRRVYVDFEGISFKRKFMVGLEPDTIKMMIGSMKIDSLGML
TDLSECEGRLFPVGYQCSRIYWSTVDARKRCWYKCRVLEYRPKLNQEEPDALGVQEENHT
IAHSPAVPADANLGEKHLQDVAPPLPPPERHSPAQNPGPLPPPEPAASKPKSLSGARIKV
PNYSPTRRPISGVSSRPLPSPGSASSMSHHILTVGDPDFPTPRRTQRLSPLSPSGAPRTR
RSSLPPQATANRTSPPSTTLRAMPPLPDEPLAGSGFKHTSTSEGQRPTPTSPPPSPPAVP
PELAFELNVSDLEFDDSLLDEPFQEEELGVPRTCPSPGLGLPQLDGLGDVESEEEGEAGR
YFRFPRTVVTREPPLPPYPLDLPLPHIHQLDGIDDGTDSEADATGGHPSAKGKQVEPRVD
RELAGPAPAPEDLPSDIVDFVLKNMDAPESKAPLPVCPNRTSPPPPPPTSASLNGTESAL
PSPAPDPAPTLMLSCAQVPSGPEVRVLGSEGQKPSSRIILVNKLGQVCVKVQGEEGPFNA
QDGEQASGCKAKPNPAPPQPAPSLNTVILRAPLSLAPSPVPTWTIRGPVLSMVPMMNVVG
TAPQAAGGQLALGLPQTCLLQPVAMNPGVLSLPSLVSLPSPRPAIRVKRVSTFVGYVPPK
KAKVDGVSEEEPLPVSPAGTPGHLVNNCLSGNTAGSSIGKVRMKTPTAKGILDLDALKEE
ASAAGKNELSPMEHSPASTVLHSHPGTPDQSQEPLLEPIWHRYTVGLSSSDEDNLNQEDK
ENEVPRKTQPHLRFEITSEDGLNVQADSIEGAWKAVIEKVQEARTNARLKHLSFAGMNGV
RMLGMHHDAIIFLVEQLYGAKACHKYKFRYHQHEGEEEELPLNPHGCARAEVYVRKCTFD
MFNFLASQHRVLPEGGPYDEEEDEVQLKSTRRATSLELPMAMRFRHLKKTSKEAVGVYRS
AIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKYYDSKGIGCYMFRIDDFDVVDAT
MHGNAARFINHSCEPNCYSRVIHVEGQKHIVIFALRRIFRGEELTYDYKFPIEDAGSKLP
CNCGAKRCRRFLN
NT seq 5084 nt NT seq  +upstreamnt  +downstreamnt
gtcgtacggtagtgaagcccattgtcccttgggattcagaggattctcaggaggagttcc
cagccccttgggaagtcattctaggggccacagagacggccgagcaagattccctgctgc
agcgcaagtcggcgaggcgctgcgtcaagcagaggccctcctatgacatatttgaatcct
ccgactccgacgcagagcctgtgtctggctcggccacgcatcgccggaaatcttcccggg
actcagacaaggatccacttcacaccctcttgggggattggcgtcagctggatgggaaag
agatgcttgttgacccgtcattctctccgccgtttccccccccacccatggactccgagg
agcagagcagaccccgcagaacacctctccagccggtggtgcagctgaaggcccggaaga
ggccagagaaggatgtctcctcttccggcaccctcccgtccatctccaatggctggaatg
ggaagcagaaatctacggacggcgtccaccggctcagagtggatttcaagcttgtgttct
gccaggtgtgttgtgaccctttccacatcttctgcctggaggaggatgagcagccgctgc
cggagcaggaggagagctggtgttgccgccgctgcaaattctgtcacgtctgcggccgca
aaaacaaggcatccaagcaactgctggaatgcgagcgctgcaggaactgctatcacctgg
cttgtctggggcccaactaccccacgaaacctttccgtaagaggaaaggctggatctgct
cggcctgcatccgctgcaagagctgcggcaccgctcctgggaagaactgggacaccgagt
ggtctagcgactacagcttgtgctccgcctgctcggtgctgtacgataaaggtaattact
gccctatctgcttgcactgctatgaggacaatgactacgagagcaagatgatgcagtgtg
ccaagtgcgaccactgggttcacgccaagtgcgagggcctttcagacgagggctatgaga
tcttgtccaacctacccgagagagtctgttgccccgacgacggcgtgaaggttcacctgc
ggacctgcgacctgcgcacggtcggcaagctctttgagcagggtcactattcgtctgtgc
acagcttccatgaggacatggtgggcgtcctgttggggcacatggaggagggccaggctg
gccttaacgcaaaggcattctacatcgagctgatgggaaagttcttcagctggtttgacg
ctcaggatccgaagcactggacacgcaacagcatcctccccaacggcatgcttcccaatg
cagtcctgcctccctcctctgaccacatctacgctcagtggaagcagccggaggagctca
gccctggggccaacagtcacctgacgcccacgggaccagagaagacagctgggaaggacg
cagagcaggccttagcacagcaggagttcgctgacccagaagacaagcgacagtgtgccc
tgtgcctccagtacggcgatgccccttccaaggatgcaggcaggctgctgtacattggcc
agaatgagtggacccacgtcaactgcgccatctggtcggctgaagtctttgaggagaatg
acggctccttgaagaacgtgcatgccgccgtggcccggggccggcagatgcgctgtgagc
actgccagcgcacgggggccaccgtcggctgctgcctctcggcctgcctcagcaattacc
actttatgtgcgcccgcctccgccactgcaccttccaggatgacaagaaggtcttctgcc
agaagcatgtcgacctcttggatgggacggagatagtcgccgaagacggctttgatgtct
tgcgccgggtctacgtcgatttcgagggcatcagtttcaagaggaaattcatggtgggct
tggagccagacaccatcaagatgatgataggttccatgaagatcgatagtctgggcatgc
tgacggacttgtcggagtgcgaggggcgcctctttccagtcggctaccagtgttcccgga
tttactggagcactgtggatgcccgcaagcggtgctggtacaagtgccgggtcctggagt
accggccgaagctgaaccaggaggagccggacgcgctgggggtgcaggaggagaaccaca
ccattgcgcacagcccagccgtccctgcagatgctaaccttggagagaagcaccttcagg
atgtggccccgcccttgccgccaccagagcgccactcccccgcacagaacccagggcctc
tgcccccgccggaacctgctgcctccaagcccaaatctctctctggagctcgcatcaaag
tgcccaactactcccccacgcggcggcctataagtggggtgtcgtcccgcccgctgccct
cgcccgggagtgcatcatccatgtcccatcacatcttgacggtgggtgacccggacttcc
ccactccacgccgcactcaacgcctcagccctttgtcgcctagcggtgccccccgcaccc
gccggtcttccctcccccctcaagccactgcgaacaggactagtccccccagcaccactc
tcagggcaatgccgcctctcccagacgaacccctcgctgggagcggctttaagcacacgt
ctacctccgaagggcagcggcccacacctacctcaccccctccctcgccccccgctgtgc
ccccagagctggctttcgagctcaacgtctccgacttggaatttgacgacagtctcttgg
acgagccctttcaggaagaggagctgggcgtgccgcggacgtgcccctcgcccggcctgg
ggctgcctcagctggacgggctgggggacgtggagagcgaggaggaaggagaggccgggc
gctacttccgcttcccccgcacagtggtgacgcgagagccgcctctgcccccgtacccgc
tggacctgcccttgccccacatccaccagctggatgggatagacgacggcacggacagcg
aggcggatgccacgggggggcacccgtctgccaagggcaagcaggtggagccgagggttg
acagggagctggctggccccgctcccgctccggaggacctcccctccgacatcgtggact
ttgtgctgaagaacatggacgcccccgagagcaaggccccgctgcccgtctgccccaacc
ggacctctccgcccccgccgccccctacctccgccagtcttaatggcaccgagtcagccc
tcccgagccctgctccggatcccgccccgaccctaatgctcagctgcgcccaagtgccca
gcggccccgaggtgagggtgctgggctccgagggccagaagcccagctccagaatcatcc
tggtgaacaagctgggccaggtctgcgtgaaagtgcagggcgaagaaggcccgttcaacg
cccaagacggggagcaggcttccggctgcaaggccaagccaaaccctgccccgccacagc
ctgcgcccagcctgaacacggtcatcttacgggcacccctgagcctcgctccgagccctg
tccccacctggaccatccggggcccggtgctcagcatggtgcccatgatgaatgtggtgg
gcaccgcacctcaggccgccggagggcagctggcgctggggctcccccagacctgtctcc
tgcagccggtggccatgaatccgggggtgctcagcctcccaagcctggtgtccttgccta
gcccccggccggccatccgggtcaagagagtctccaccttcgttggatacgtgcccccca
agaaggcgaaggtggacggagtcagcgaagaagagccgctgccggtgtcgcccgcgggga
ctcccggtcacttggtcaacaactgcctttctggcaacacggcgggctccagcatcggga
aggttcggatgaagacccccacggcaaagggcatcctagacctggatgcgctgaaagagg
aggcaagcgccgccggcaagaacgagctgtccccgatggagcactcccctgcctccacag
tgttgcactcccatcccggaacgccggatcagagccaggagcctctgctggaacccatct
ggcacagatacacggtgggcctttccagctcggacgaggacaacctgaaccaggaagaca
aagagaacgaggtgccccgcaagacgcagccccacctgcgcttcgagatcaccagcgagg
atggcttgaacgtgcaggctgacagcatcgagggtgcctggaaagcagtcatcgagaagg
tgcaggaagctcggaccaatgccaggctgaagcacctgtcctttgcaggcatgaatggcg
tgcggatgctggggatgcaccacgatgccatcatcttcctggtggagcagctgtatggcg
ccaaggcctgtcataagtacaagttccggtaccaccaacacgaaggcgaggaggaagagc
tgcctctcaacccccacggctgtgcccgggccgaagtctacgttaggaaatgcacctttg
acatgttcaacttcctggcgtcccagcatcgtgtgcttcccgagggtggcccctatgatg
aagaggaggatgaagtgcagctcaagtccactaggcgagcgaccagcttggagctaccca
tggctatgcgctttcggcacttgaagaaaacctccaaggaagctgtaggtgtctacaggt
cagccatccacggccggggtctgttctgcaagcgaaacatcgacgccggcgagatggtga
tagagtactcgggcatagtcatccgatctgtgctgacagacaagcgggagaagtactatg
acagcaagggcatcgggtgttacatgttccgcatcgacgacttcgacgtggtggacgcca
cgatgcacggcaacgccgcccgcttcatcaaccactcctgcgagcccaactgctactcgc
gcgtcatccacgtggagggccagaagcacattgtcatcttcgccctgcggcgcatcttcc
gcggggaggagctcacctacgactacaagttccccattgaggacgccggcagcaagctgc
cttgcaactgtggggccaagcgctgccgccgctttctcaactga

KEGG   Gekko japonicus: 107109138Help
Entry
107109138         CDS       T04299                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2B-like
  KO
K14959  [histone H3]-lysine4 N-trimethyltransferase MLL4 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107109138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107109138
   03036 Chromosome and associated proteins [BR:gja03036]
    107109138
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107109138
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107109138
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107109138
   HMT complexes
    MLL3/MLL4 complex
     107109138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CXXC
Motif
Other DBs
NCBI-GeneID: 107109138
NCBI-ProteinID: XP_015265199
LinkDB All DBs
Position
Un
AA seq 1166 aa AA seqDB search
MAAAAAAVGGGGGDATLGSLLGLGRSLRRLQGLLGDSSSSDGAEEPDEFLGFHSEDEASQ
SSLRTALRSKRGAALPARGRKKRALSEDSRSKRLAKQKAAESQRERMVKALAELLQRAKG
PPARLGRPPGSGPKIGRMLPEQTKVGLEAGGSVKATLSPTLPPQTGKNPNSIASARPRGR
PRGSFTKRPRTTPGPPCQSVEAPCSLPEPEHKSPSPSPRPAVSPSPPSPEPKKPPLILKF
FSKARRHKSGKLVVTHVRLKGSGHRRGRKRKWSVVQKKRSSPLPSLSVSESEAPLSESEA
SAPEREQKGVASTLESQPEVLDESPEPQPELPAPKAEAQPDVFAQEPEKQPEAPPPMVEV
CRPELEAPTPGDGVPASPNGLSGKQGQQQADPQSDRTGALPVEGSSSISRSTRAQCSKRG
RGRPPLTASQRAQRMASQQQPTKAREEALAAAQQAGGTGSEEAPALKATFLKNIRQFIMP
VVSARSSRLIRTPRRFIDEIPQKTAKPVESPAAPEGSCPDKQEALLSSLPVTSLQLTPPN
PSSPSKDSSRALSPPPSPNVPHIASSASALPEKRRSILREPTFRWTSLSPTSSPKDLGKT
LFHLPSEDSPSLPSTPTLTPSPPAKRTPLLRAPQFTPSEAHLKIYESLTVSSEESESAHA
SPEVRRDTPASQQQEAPTLPNEPVVVTRSSKRLMGRTNHLTLPLFTEVPRPLGAQGKELI
TMEDVNSPGVVHKVAIRRVVPPAVHPKEEEADSSESEAEPASPGSGELPPPPEVPKPIMA
QLSSMDKVYSLLTRAKVQLFKIDQQKNFKLGPGCQTIKIDVLEPPKVQSKQEPSSEPKAD
GEDGKDARKQGQESPVQGPRIKHVCRHASVALGQSRAMVPEDVPRLSALPLREREEIAAS
PTVEETSSASESESGHQKQVKADAAVKAAPHPVRRHVSHHHHGKKNRMTRCGKCKGCQKL
QDCGECINCLDKPKFGGPNTKKQCCVYRKCDKIEARRVERLSKKGRTVVKPIVPWDSEDS
QEEFPAPWEVILGATETAEQDSLLQRKSARRCVKQRPSYDIFESSDSDAEPVSGSATHRR
KSSRDSDLLPMDSEEQSRPRRTPLQPVVQLKARKRPEKDVSSSGTLPSISNGWNGKQKST
DGVHRLRVDFKVREECPAARQPLEPP
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctgctgtgggaggcggcggcggcgacgccaccctggggagcctc
ctgggcctcggacggagcctgcgccgcctgcagggcctgctgggtgacagcagcagcagc
gacggcgcggaggagccggatgagtttctgggcttccactccgaggatgaggcctcccag
agttctttgcgcactgctctacggtctaaaagaggtgcggctctgcctgcccgcgggcgg
aagaagagggcgctctccgaggacagccgttccaagcggctggccaagcagaaggccgcc
gagtcacagagggagcgtatggtgaaggccttggctgaactgcttcagagggccaaggga
cccccagcccgattgggcaggccaccgggttcgggccccaagataggcaggatgcttccc
gagcagactaaagttggcctggaagcaggcggttccgtaaaagccaccctctctcccacc
cttcctccacagaccgggaagaatcccaactccattgcatccgccaggccacgcggccgg
ccacggggctccttcaccaagagacccaggaccacgcctggacctccttgccaaagcgtc
gaagctccatgttccctccccgaacctgagcacaagagcccttcgccctcaccacgccca
gctgtcagcccctccccaccatccccagaacctaagaagcccccactcatcctaaagttc
ttttccaaggccaggcggcataagtccggcaagttggtggtcacccacgtccggctaaag
ggctctggccacagaaggggccgcaagaggaaatggagtgttgtgcagaagaagagaagc
tccccgctcccctccctgtctgtctctgagtcggaggcccctttgtcggagtcggaagct
tctgcccctgaacgggaacaaaaaggggtggcttcgactctggagtcgcagccggaggtt
ctcgatgagagtccagaaccacagccagaacttccagccccaaaggcagaggcacaacca
gatgtgttcgctcaggagccagagaaacaaccagaggctccgccccccatggtggaagtc
tgtcgaccagaactggaggctccgactccaggagacggcgttcccgcttcaccgaatgga
ctttccgggaaacaagggcaacagcaggccgacccacagagtgacaggacgggggccctt
cccgtggaggggtcttccagcatctcccgttccacccgggcacagtgttcaaagcggggc
cgtggccgcccgcccctcaccgcttcccagcgggcccagcgcatggcctctcagcagcaa
ccaaccaaggcccgagaggaggctttggcggccgcccaacaggctggtggcaccggctcc
gaggaagccccggctctcaaggccacgttcctgaagaatatccgccagttcatcatgcct
gtggtgagcgctcgctcgtcacgcctcatccgcaccccccgccgctttatcgacgagatc
ccgcagaagacggccaagcctgtagaaagccctgctgccccggaagggtcttgtcctgac
aaacaagaggccctcctgtcgtcgttgccggtgacctcactgcagctgactcccccgaac
cctagctctccgagtaaagatagttccagagctctctccccgccaccttcccctaacgtt
ccccatatagcttcctctgcttccgccctgcctgagaagcggcgttccatcctccgggag
cccactttccgctggacttccctgagccccacttcatcccccaaagatctgggcaagacc
ctgttccatcttcctagcgaagattccccttctttgcccagcactccgacgctaacccct
tcgccccccgccaagcggacccccctgctgcgggcccctcagttcacgccgagcgaagca
caccttaaaatctacgagtcgctgacggtgtcttccgaggagtccgagtcggcgcacgct
tcccctgaggtcaggagagacaccccggcatcgcagcagcaagaagctcccaccctcccc
aatgagccggtggtggtaacccgcagcagcaagaggctgatgggaaggacgaaccatctc
accttgcccctcttcacggaggtcccgagaccgctcggggcccagggcaaagagctgatc
accatggaggatgtgaattctcccggtgtggtgcacaaggtggccatccgcagggtcgtg
cctccggcagtccacccgaaggaggaggaggccgatagctcggagagcgaggcggagccg
gccagccccggttcaggagagctaccgccccctccggaggtgccgaagcccattatggcc
cagctgtcgagcatggacaaagtgtacagcttgctcactcgtgccaaggtgcagcttttc
aagatcgatcagcagaagaatttcaaactgggcccggggtgtcaaaccatcaagatcgat
gttctggagcccccaaaggtccagagcaagcaggagccgagttcggaacctaaagcggat
ggagaggatgggaaagatgcaaggaagcagggccaggaatctccggtgcagggccctcga
atcaagcacgtgtgccggcacgcctcggtggcactggggcagtctcgtgccatggtgccg
gaggatgtgccacgcctcagtgccctgccactgcgggagagggaggagatcgctgcttca
cccactgttgaggagacctcctcggcctccgagagcgagagcgggcatcagaagcaggtg
aaggcagacgcagccgtcaaggccgcgccgcaccccgtgcgccgccacgtctcccaccac
caccatggcaagaagaaccgaatgacccgctgtgggaagtgcaaaggctgtcagaagctg
caggactgcggggagtgcatcaactgtctggacaagccaaagtttggtgggccgaacacc
aagaagcaatgctgcgtgtatcggaaatgcgacaagatagaagcgcggcgggtggagcgg
ctgtcgaagaaaggtcgtacggtagtgaagcccattgtcccttgggattcagaggattct
caggaggagttcccagccccttgggaagtcattctaggggccacagagacggccgagcaa
gattccctgctgcagcgcaagtcggcgaggcgctgcgtcaagcagaggccctcctatgac
atatttgaatcctccgactccgacgcagagcctgtgtctggctcggccacgcatcgccgg
aaatcttcccgggactcagatctgcttcccatggactccgaggagcagagcagaccccgc
agaacacctctccagccggtggtgcagctgaaggcccggaagaggccagagaaggatgtc
tcctcttctggcaccctcccgtccatctccaatggctggaatgggaagcagaaatctacg
gacggcgtccaccggctcagagtggatttcaaggtaagggaagagtgtccggctgcaagg
cagcctctggaaccaccctga

KEGG   Gekko japonicus: 107110772Help
Entry
107110772         CDS       T04299                                 

Gene name
SETD7
Definition
(RefSeq) SET domain containing lysine methyltransferase 7
  KO
K11431  [histone H3]-lysine4 N-trimethyltransferase SETD7 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
gja04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107110772 (SETD7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107110772 (SETD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107110772 (SETD7)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107110772 (SETD7)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107110772 (SETD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MORN SET MORN_2
Motif
Other DBs
NCBI-GeneID: 107110772
NCBI-ProteinID: XP_015267063
LinkDB All DBs
Position
Un
AA seq 411 aa AA seqDB search
MGGERRVWGDRAATEALASVRGGSGGGGSSAPACSASCRGRQRRAADSDEETLEETVEGA
LDDDGMPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYT
YEDGGALHGSYMDGELNGPAQEYDADGRLIFKGQYKDNIRHGICWIYYPDGGYLVGEVNE
EGEMTGEKIAYVYPDGKTAYYGHFIDGEMLEAKLANLLSIEEGKPQFEVVPGSPVYSFDK
STSSCISTNALLPDPYESERVYVDTSLISSAGEGLFSKIAAEAGITMSFYNGIRITHQEV
DNRDWALNGNTISLDDETVIDVPEPYNHAAKYCASLGHKANHSFTPNCHYESYVHPRFGL
IKCIRTIRAIEKDEELTVAYGYDHNPSGQNGPEAPEWYRMELKAFQAAQEK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggagaggcgagtgtggggagacagagcggcgacagaggcgctcgctagcgtg
cgcggcggcagtggcggcggcggcagctccgcgcctgcctgctcggcgagctgtaggggg
agacaacggcgggcggcggacagtgacgaggagacgttggaagagaccgtcgagggagca
cttgatgatgatgggatgccccatggattttgtacggtcacatattcatccacagacaga
tttgagggaaattttgtgcatggagagaaaaatggtcgtggcaagtttttcttttttgat
ggaagtacacttgaaggatattacgttgatgatgctctgcaaggccagggagtgtacact
tacgaagatggaggagctcttcatggctcttacatggatggagaacttaatgggccagcc
caggaatatgatgctgatggacgactgatatttaaagggcaatacaaggataatatccga
catggtatttgttggatatactacccagatggtgggtatctggttggagaagtcaatgaa
gaaggagagatgactggagagaagatagcctatgtgtaccctgatgggaagacggcctat
tatgggcacttcatagatggtgaaatgttggaagcaaagttggcaaatcttttatccata
gaagagggaaagccgcaatttgaagtagtgccaggcagcccagtgtacagttttgataaa
tctacttcatcctgcatttctacaaatgctcttcttcctgatccttatgaatcagagagg
gtatatgtggatacatctctcatttccagtgctggagaagggttgtttagtaaaatagca
gctgaagctggcataactatgtccttttacaatggaatacggattacacaccaggaggtg
gacaacagggactgggctttgaatggaaatacaatatccctagatgatgaaacagtcatt
gacgtaccggaaccctacaaccatgcagccaaatattgtgcctcattagggcacaaggca
aatcactcttttacacctaactgtcattatgaatcgtacgttcatccccgttttgggctg
attaaatgtattcgcactattagggctattgaaaaggatgaagaattaaccgtggcatat
ggctacgatcacaatccctctggacaaaatgggccagaagcaccagagtggtatcgcatg
gaactgaaggccttccaggctgcccaggaaaagtga

KEGG   Gekko japonicus: 107111562Help
Entry
107111562         CDS       T04299                                 

Gene name
NSD1
Definition
(RefSeq) nuclear receptor binding SET domain protein 1
  KO
K15588  [histone H3]-lysine36 N-dimethyltransferase NSD1 [EC:2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107111562 (NSD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107111562 (NSD1)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107111562 (NSD1)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107111562 (NSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP C5HCH SET AWS PHD PHD_2
Motif
Other DBs
NCBI-GeneID: 107111562
NCBI-ProteinID: XP_015268025
LinkDB All DBs
Position
Un
AA seq 2445 aa AA seqDB search
MDQACEVSRRSCLPPFASSLVLDAPEDEDSPYGGEGQSRSPEPPNGCTMAASKAAAYGQD
PSSCYIPLRRLQDLASMINAEYLNGSKDGSDCLQELERSDISSPEHPELCSSSVLVDPED
LHIRQDTARLLDFETLSPCLEEDDDEESETSFLTAEENPEEGIKFPMKNTATTSCSKEAE
FGNGTELIQENQQSTSIGIRYNEAISALLSPPIPPEQIQSNSCKMSGVGTRTEKADLRPV
SYSPGDTKLKKEKEFSITKVSEKEDPGQSPITLGNLIERLETSITAKPSTAGLPSGHIKK
KPIPVKYEAGDLVWAKFSRRPWWPCKIYHDPMLDTHTKMKVSNRRPYREYYVEALGESSE
RAWVVGKAIVVFEGRHQFEELPVLRRRGKQKEKGYKHKVPKKFMAKWEISVGLANECLKQ
SDIQKCSQTSSHPDNEKEKGMHLMESCTKGSLSEECKQLNGCFRSLALDCKHSADEKTKT
FKSRMKKSSDMRRRNRVRKSSTKLEASKRDSGGKVPVNKVKNMITSDLPDKQASHELCRI
AKSLMGSKGTVENYLLSSFGERQFDKKSMKTEYKVSDRVCQQETPKADLKKKKNPTGFMC
SSKLQHHYSAADAGTEEQMESDSSDDDTYDLDPLDQSIAAAAHTVLKNGDSLNNRGKELS
SGQKNIKRSSYVSKTSNRSCKSLEGSLDINANVEAGGEEFHELSLAAEVASVYRNDNLTL
VDKHTTLQSKGFTSQMDTKQSQFRSIKCKHKGTAAGTDSSLKEDICSPNCCFPAAKGSSG
SQLDTPAKSGKADGSKLLNSTNEKPRDSAEIETAVVKHVLSELKELSYRPMNTEAKDCGP
AKTTGSLLFSSVSGQNHLPIEPDYKFSTLLMMIKDMHDSKTKEKQIMTTQNIVSYRSPNS
GDSSGSNTPSDLTSLPTMGSTHKLEKNRDSVQEPECQKPKEVAQSEKKRLRKPSKRLLEY
AEEYDHIFAPKKKKKSRESFRKASSVEKPENKQDCSSGKQGQNKYLEKESMDSVSPASSS
KESPPVLEAERCLTDDPEPHSMEPRSEMPVLTLSSPNVLETAAASPSQGEELLVKSGSFE
SKRQRKPTKKLLESNDLDTTFIPKREWAAIKKCSEAGPLDTEMSELYSTPQFLDTGEAPE
KAPAKQRKRKRQRRTLSAAPNKKEKGEDVLGETSNSEGDRATQGAEGSPKETAEEGSEND
HGVPSSKKMQGERGGGAALKENVCQICEKPGELLLCEAQCCGAFHLQCLGLSEMPKGKFI
CTECSTGVHTCFVCKSSGENVKRCLLPLCGKYYHEECTQKYPPTVMQNKGFRCSLHICMT
CHAANPANVSASKGRLMRCVRCPVAYHSNDFCLAAGTVILASNSMICPNHFTPRRGCRNH
EHVNVSWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWYCNDCKAGKKPHYKEVVWV
KVGRYRWWPAEICHPRTIPVNIQKMKHVIGEFPVLFFGSNDYLWTHQARVFPYMEGDVSS
KDKMAKGVDGIYKKALQEAAVRFEELKAQKELRQLQEDKKNDKKPPPYKHIKVNRPIGKV
QIFTADLSEIPRCNCKTTDESPCGLDSECINRMLLYECHPAVCPTGERCQNQCFTKRQYP
EVEIFRTLARGWGLQAKRDIKKGEFVNEYVGEXDXXXXXXXIRYAQEHDITNFYMLTLDK
DRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFAITNIKAGTELTFNYNLECL
GNGKTVCKCGAPNCSGFLGVRPKNQPPATEEKSKRFKRRHGKRKSQTEIMKEREDECFSC
GDGGQLVSCKRPGCPKVYHADCLNLTRRPAGKWECPWHQCDVCNKEAASFCEMCPKSFCK
QHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIREYAPSTESAAGCKNTESSDQQPSAT
DPKSQPSEKLPLTVALRLQPSDKPPSSSLALRLKSSEKPPSSVALKLQPSDKSPSTVALR
IQPSDKLSSTLALSLKPSDKLPSTLALRLKPSDKLSSALALRLQSSDKPLSAVALRLHPS
EISPSTVALRLQPSEKLACTITQKLQPSEKLSSTVVHELQPSNKRPTTETSGPQDKKPSV
EALGSETSDKIPASETLEPEMSDRSPSADTTGTRMLNKPSATEKAKLPVSDKLSEPESQP
LEGATSVGPLPQPSGKSVTPVSLRSQPAVRSATPIALRSKPSEKPMGSWPQTPNRLSTPV
DTWSVPSDKPSTTTELRPQLSDRLPTPLSPSPLLSEKALRPVDQNAQPKERGSVSMEQNP
QPKERTSVYDEQSCRSTGKLSVYAGQTTCPLENLQIREQPSRLSAKGLSSKEQSLWTAEK
LQAPEPSLCPSQEVAPATPMEQTFWSTERLCAFEQPPWPAKEAPHPSGQTSWLTRNIQTL
EQISWLSGKAQTSVGQDILPLSEQNSVLVLNQDSPGHEPTESKPK
NT seq 7338 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagcctgcgaagtgagcaggaggagctgcctgccccctttcgccagctcctta
gtgttagatgccccggaggatgaggacagcccttatgggggggagggccagagccgtagc
cccgagccacctaatgggtgcaccatggcagcgtctaaggctgctgcctatgggcaagac
ccttcctcctgctacatcccgctgcgcaggctgcaggatttggcctcaatgatcaatgct
gaatatctcaatggctcaaaagatggctctgactgtttgcaggaactcgagaggagcgac
atctccagccctgagcacccggagctctgcagttcttcagtgctggtggacccagaagac
ttgcacatccgacaagacactgcaaggctcctggattttgagacactctctccttgtttg
gaggaggatgacgatgaagagtctgaaacttcatttctaactgcagaagaaaacccagag
gaaggaattaagttcccgatgaaaaatacagccacaacatcctgcagtaaggaggcagaa
tttgggaatggaacagaactgattcaagagaatcagcaaagcacctccataggcattaga
tacaatgaggccatttctgccctgctatcaccccccattcctccagagcaaatacaaagt
aattcttgcaaaatgtctggagtaggaactagaactgagaaagcagacctacgtccagtg
tcttactcgcctggagatacaaagttgaaaaaagagaaagagttcagcattacaaaggta
tctgaaaaagaagatccaggtcagagtcccatcactttaggaaacttgatagaaagactt
gaaacgtcaattacagcaaaaccttcaacagcaggattaccatctggtcacatcaagaag
aaacctattcctgtgaagtatgaagctggagatcttgtgtgggcaaagttcagtagacgt
ccatggtggccctgtaaaatttatcatgatcctatgctagatacgcatacaaaaatgaaa
gtttccaatcgtagaccatatcgggagtattatgtggaagccttaggagaatcatctgaa
agagcctgggttgtaggaaaggctattgtagttttcgaaggaagacatcaatttgaagaa
ttgcctgtccttcggagaagagggaaacaaaaagaaaagggctacaagcacaaggttcct
aagaaatttatggctaaatgggagatcagtgttggacttgcaaatgaatgtctcaagcag
agtgatattcagaaatgcagccagacttctagtcatccagacaatgagaaggagaagggc
atgcatttaatggaatcttgtaccaagggctccttaagtgaagagtgcaagcaactgaat
ggatgttttagatcattggcattggactgtaaacattctgctgatgagaagacaaagaca
ttcaaatcgcgaatgaagaaaagttctgatatgaggaggagaaatagagtaagaaaaagt
agcaccaaactggaggcatccaagagagacagtggggggaaagtgccagtgaataaagtt
aaaaatatgattacttcagatctgccagataagcaggcttctcatgaactgtgcaggata
gcaaagagcctaatgggatccaaaggcactgtggaaaactacttgctctcttcttttgga
gagagacagtttgacaagaaatctatgaaaaccgaatacaaggtctctgatagggtctgc
cagcaggagacacccaaagcagacttgaagaaaaagaaaaacccgacaggctttatgtgc
agttcaaaactacagcaccactattctgcagccgatgctggaacagaggaacaaatggaa
tctgattcatcagatgatgacacctatgatctagacccccttgaccaaagtatagcagca
gcagcccatactgtcctgaaaaatggtgattctctaaataacagagggaaggaactgtct
tcagggcaaaaaaacattaaacgttcttcatacgtctcaaaaaccagcaatagaagttgc
aaatctctggaaggctctctagatataaatgccaatgttgaagcaggaggtgaggaattc
catgagctctcccttgcagccgaggtggcttcagtttacaggaatgacaatctaaccctt
gtagataagcacactacactccaaagtaaagggtttacaagtcagatggatacaaaacag
tctcagttcagaagtataaaatgcaaacataaaggaactgctgctgggacagactcttct
cttaaagaagacatatgtagccccaactgctgctttcctgctgccaaaggttcttctggt
tctcagttagatacacctgccaaaagtgggaaggctgatggctcaaaactgctgaacagc
acaaatgagaaacctcgtgattctgctgaaatagaaacggcagtagtgaagcacgtgctt
tcagaactgaaggagctgtcttataggcccatgaatacggaagctaaagactgtgggcca
gctaagaccacagggtccttgcttttttcctctgtctctgggcagaatcacttgcctatt
gagcccgattataaattcagcaccttattaatgatgatcaaggatatgcatgatagtaag
acaaaagagaaacaaataatgactactcagaacatagtctcttataggagccctaacagc
ggtgatagttccggaagtaacactccaagtgatttgacatctttgcctacaatgggatcc
actcataaattagaaaaaaaccgagatagtgtgcaagaaccagagtgtcagaaacccaaa
gaagtagcacagtcagaaaagaaacgccttagaaagccaagtaaacgacttctggaatat
gcagaggaatatgatcatatatttgcacctaagaaaaaaaagaagagccgggagtcattt
cgtaaggcaagttctgtagagaagcctgaaaacaaacaggattgcagcagtggcaagcaa
ggtcagaataaatatctagaaaaggagtccatggattcggtttcacctgcttcttcatct
aaagagtctcctccagtccttgaagctgaacgttgtctgacagatgaccctgagccccat
tccatggaaccaaggtctgaaatgcctgtgttgacattgtcttcaccaaatgtgttggaa
actgctgctgcttccccttcacagggagaggaactgttggtgaaatcagggagctttgag
agcaagcgtcagaggaagccaacgaaaaaactcttagaatccaatgatttggataccaca
ttcataccaaagagagagtgggccgccataaagaagtgttctgaggctggtcctttggat
actgaaatgtctgagttgtattccacacctcaatttctggacactggtgaagctcctgaa
aaggctccagcaaaacagagaaagcgaaagcggcagcggcgaactctgtctgcagctccg
aataaaaaagagaagggtgaagacgtcctgggagaaacctcaaattcagagggagataga
gctactcagggggcagaaggaagccccaaggagactgctgaagaagggtctgaaaatgac
catggagtgccttcatccaaaaagatgcagggggagcgtggaggaggagccgcccttaag
gagaatgtgtgtcagatctgtgaaaaaccaggtgagctgttgttgtgtgaggctcagtgc
tgtggtgctttccatctgcaatgcctcgggctctcagaaatgcccaagggcaagttcatc
tgcactgagtgttccacaggggtccacacatgctttgtatgcaagagcagtggagaaaat
gtgaagcggtgcttgcttcctttgtgtgggaagtactatcatgaagaatgtacacagaaa
tatcctcccacagtcatgcagaacaagggctttcgatgttcattgcacatctgtatgact
tgccatgcagccaaccctgcaaatgtgtctgcatctaaaggtcgcttgatgcgttgtgtt
cgatgtcctgttgcataccattcaaatgatttttgccttgctgcggggacagtgattctt
gcttccaatagcatgatctgcccgaatcattttacccctcgaagaggctgcagaaaccat
gagcatgtaaatgtcagttggtgctttgtctgttctgaaggtgggagccttttgtgctgc
gagtcttgtcctgctgccttccaccgggagtgtctgaacatcgacatgcctgaagggagc
tggtattgtaacgactgcaaggccggcaagaagccccactataaggaggtggtttgggtg
aaagttgggcgttacaggtggtggcctgctgagatttgccaccctaggaccatccctgtc
aacattcaaaagatgaaacacgtcattggtgaatttcctgtgctgttttttggatcaaat
gattacctttggacacaccaggctagagtgttcccctacatggaaggagatgtgagcagc
aaggacaagatggcaaaaggagtggatggcatttacaagaaagctctgcaggaagcagcc
gtgagatttgaagagctaaaggctcagaaggaactgaggcagctacaggaagacaaaaag
aatgataagaagcctcctccgtacaaacatatcaaggtaaacaggcctataggcaaagtg
cagatcttcactgcagacctgtcagagataccacgctgcaactgcaagacgactgatgaa
agcccctgtggcctagactcagagtgcattaatcgcatgttgctatatgagtgtcatcca
gcagtgtgtccgactggggaacgctgtcaaaaccagtgcttcaccaagaggcagtaccca
gaagtagaaatcttccgcacattagcccgaggttggggcttgcaagctaaaagagacatt
aaaaagggtgagtttgtgaatgaatatgttggagaanctgatnnnnnnnnnnnnnnnnnn
ngaatccgctatgctcaagagcatgatatcaccaatttttacatgctgactttggacaag
gatcggatcattgatgctggaccaaagggcaattatgctcgattcatgaaccattgctgc
cagccaaactgtgagactcagaagtggtcagtgaacggagatacccgggttggccttttt
gccatcacaaacatcaaagcagggactgagctgactttcaactacaacctggagtgtttg
gggaatgggaagacagtttgcaaatgtggtgctccaaactgcagtggcttccttggagtg
cgaccaaagaatcagccacctgctactgaagagaagtccaagaggttcaagagacgacat
gggaagcgcaagtcacagacagaaatcatgaaggagcgagaggacgagtgtttcagctgt
ggggatggaggacagctggtttcttgtaagaggccaggctgtcccaaggtgtaccatgcc
gactgcctcaacctgactagacgtcctgcagggaaatgggagtgtccttggcatcagtgt
gatgtatgtaacaaagaagcagcttctttctgtgagatgtgccccaaatccttctgcaag
cagcatcgagaaggcatgctattcatctctaagttggatggacgcctgtcatgtacagaa
catgatccttgtggccctaaccctctagagccaggagagattcgtgagtatgcgccttcc
acagaatcagcagctggctgcaaaaacactgagtcatcagaccagcagccttctgccact
gacccaaaatctcagccatcagagaagctacctctgactgtggccctgaggctgcagccc
tcagataaaccaccttcctcttcactggctctgagattaaagtcctcagaaaagccacct
tcctcagttgcactgaagctacagccctcagataaatcaccttccacagtggcactgagg
atacaaccatcagacaaactttcctccaccctagccctgagtttaaaaccttccgacaag
ttgccctctaccctggccctgaggttaaagccctcagacaaattatcctccgccctcgcc
cttaggttgcagtcgtctgacaagccactctctgccgtggctcttaggctacatccctca
gaaatatcaccctccactgtggccctgaggctacagccttctgaaaaactagcctgcact
ataacccagaagttgcaaccctcagaaaagctatcctccactgtagttcatgagttacag
ccctcaaacaagcggcccaccacagagacatcaggacctcaggacaagaaaccttctgta
gaggcgttgggatctgagacatcagacaaaattcctgcttcagagacactagagcctgag
atgtcagataggtcaccttctgcagacacaactgggacccggatgttaaacaagccatct
gccacggagaaggcgaagctcccggtgtcagacaagctttcagagcctgaatctcagcca
ctggaaggggccacttctgttggccccctgcctcagccctcaggcaagtctgtcactcct
gtgagcctgagatctcagccagcagtcaggtcagccactcctatagccctgaggtctaag
ccatcagaaaagcctatgggatcatggcctcagacacccaacaggctttctaccccagtg
gatacttggtctgtgccatcagacaagccctctaccaccacagagctgagacctcagcta
tcagataggcttcccaccccactaagtccaagtcctttgctgtcagagaaagcactgagg
cctgttgaccagaatgctcaaccaaaagaaagaggctctgtgagcatggagcagaaccct
caaccaaaagaacggacatctgtatatgatgagcagtcctgtagatctacagggaaactt
tccgtatatgcggggcaaacaacctgccccttagagaacttgcaaatacgtgaacagccc
tctcggcttagtgcaaaaggactgtcatctaaagaacaatcactttggacagctgagaaa
ctgcaggccccagagcccagtctttgtccaagccaagaagtggcccctgcaacccccatg
gagcagacattttggtcaacagaaagactgtgtgcatttgaacagcctccttggcctgca
aaagaagctccacatccttctgggcaaacttcatggctgaccagaaacattcagacattg
gagcagatctcttggttgtctgggaaagcacaaacatctgtggggcaggacattttgcct
ttgtctgaacaaaattcggtgctagtactgaaccaggactctcctggccatgaacctact
gagtctaaacctaagtga

KEGG   Gekko japonicus: 107112539Help
Entry
107112539         CDS       T04299                                 

Gene name
KMT2A
Definition
(RefSeq) lysine methyltransferase 2A
  KO
K09186  [histone H3]-lysine4 N-trimethyltransferase MLL1 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107112539 (KMT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107112539 (KMT2A)
   03036 Chromosome and associated proteins [BR:gja03036]
    107112539 (KMT2A)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107112539 (KMT2A)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107112539 (KMT2A)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107112539 (KMT2A)
   HMT complexes
    MLL-HCF complex
     107112539 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 RAG2_PHD Bromodomain PHD_4
Motif
Other DBs
NCBI-GeneID: 107112539
NCBI-ProteinID: XP_015269182
LinkDB All DBs
Position
Un
AA seq 3794 aa AA seqDB search
MAHSGRWRFPARPGTGAWGRRGLGGCRVRAAFWALATGDPVQKKPDEQFLGFGSDDEAKG
QSPTKSSTVKSSARKPRGRPRNILDQSSPVLSKSSLTYSPPSKPELTSAEKVKKKELKSG
EKRRGRPPALASMKFKISHMKGTPDAQKGGKEEKEALKKVKRAPSTAFQHATKIKKLRAG
KLSPLKSKFKSGKLQIGTESSQLEKAQRIRKEKDGVPLLPKEDKPAVRQSPRRIKPVRII
PSSKRTDATIAKQLLQKAKKGAQKKIEKEAAKLQGRKARTQLKNIRQFIMPVVSAISSRI
IKTPKRFIEDEDYDPPIKIARLESTPNSRFSATSCGSSEKSSGASHHSSQMSSDSSRSSS
PSVDTSTDSQASEEMQALSEECSNTPEVVPSSLPVSQSPENEGGERRRRRRFSVAERSFG
PKIAKKLPSLQSLSQQQPSSASPPPPLLTPPPPLQPAASVSEHAPWLMPPTIPLASPFLP
SSAAPMQEKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTP
EDVGFASGFSAPGAPAPTRLFSPLHSGTRFDLHKRSPLLRAPRFTPSEAHSRIFESVTLP
SSVSRAAGGAAATSVSLRKRKRRVFSPIRPEPRSPSHSMRTRSGRLSASELPAHPSPSSV
PSSLASISVGSLTTSALNASFTFPTHSLSQPGESVEKSQRPRKQPGVPAEPFSSSSPAPL
FPWFPPSSHTERGRNKDRASEEPSKGKESDRSVEKEKSRERDREREKENKRESRKEKRRK
APEIQSSSALFPGARVSKGRVAVSEDPAISSSAKKAVGRKKSTGTDLVADGPAVVLVDSA
TAIKTKMAKRGRGGLEKASLDLGLPAPAAGKEDGLRLPAASSISSVLAHADKMPMTDKRV
ASLLKKAKAQLCKIEKIKSLKQVDQPKGQGQESDSSEASVRGPRIKHVCRRAAVALGRKR
AVFPDDMPTLSALPWEEREKILSSMGNDDKSSVAGSEEAEPQVPPIKPIKPVTRHKPPPE
PPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSK
AYLQKQAKAVKKKEKKSKSSDKKESHAGKSQSESGQKAAPQPVLAREEHPAKRGSEPARK
PSEEKSEEGPPPAPPDHRQAPPPAARKAGKQVPAPSPPPPSSCPPRREAPKSIPAEPKKK
PALPPEAGIEQNKQKKITPRPSLPVKQKPKEKEKPPALNKPENSTLNMLNTLSNGSCSKQ
KPLTDGVHRIRVDFKEDCESENVWEMGGLGILTSVPITPRVVCFLCASSGHMEFVYCQVC
CEPFHKFCLEESERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSFHPECLG
PNYPTKPTKKKKVWICTKCVRCKSCGATTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPL
CDKCYDDDDYESKMMQCGKCDHWVHSKCENLSDEMYEILSSLPESVAYTCTHCTEQHPAE
WRLALENELQQSLKQVVAALLSSRTTSHLLRCRQAAKPPDLNPETEESIPSRTSPEGPDP
PVLTEVSKQEEQQPLDLEGVKRRLDQGGYSSVLELSDDIVKIIQAAMNADGGQPELKKAN
GMVKSFFIRQMERVFPWFNVKKSRFWEPNKVTTNSGMLPNAVLPPSLDHNYAQWQEREEN
SCAQQPPLMKKIIPAPKPKGPGEPDFPTPPPPPAAPVSSSDRGREDSPDLAPPPDVEDNR
QCALCLKYGDDGTNDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQL
RCELCLKSGATVGCCLASCTSNYHFMCSRAKNCVFLEDKKVYCQRHRDLIQGELQVVPEK
GFEVLRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGY
QCSRVYWSTTDARKRCVYTCKIVECRPPTSEPDINSTVDHDDNRTIAHSPVPPPEILANE
VHGVSAAVSPLSSDLPAHLQNCKALRIRRPSFAPVQRSPGSRPLPSAGSPAPVTHEIVTV
GDPLLSSGLLLRSIGPRRHSASPLSPPQPRSWVLSASKARAPLSRPSVGPAPHEQDWSLP
LPAEQSLGPAASRVALQSSSAPPSAQRAAVRSGSKGPPPLEGSVSLEVPPPGGSIPTSAE
KAKVLSPRDASASPRSSKASPLVAAGTAGTEPSTSQGGGMLLETPPPGLLSSKDTAASLP
LHQRAPKKEQDQPMDLPQPELTCASEEAEGKGSKTPGGSTKPPPASEPVPSVSRERRQKG
KKGTAERRSSKLPTGSGLLPGGGEQRAGPERVTPAPEPCRAVAAEKATERISRAALCHGE
GGGGTPSKDLPASQKRTVKVTLTPLRMEGESQPRSAPRESDAGGASQDSQPASVAPPLPP
GAGPVAQEGPRDPPAPGPHQSLPGRDCPLILQEGAAAKATEEGAYKRRYPRRSARARSNM
FFGLTPLYGVRSYGEEDIPFFSTSTGKKRGKRSAEGQVDGADDVSTSDEEDLYYYNFART
VVSGTEEHLVSHNLFREEEQCSLPKISQLDGVDDGSESDTSITVAARKVNPGTKRGGGGG
KENGTESLKLDRSEESGEKAHATKISAGHKSADPKTENCRAKAQSQDSLEAQLSSLDAGR
RPRASTPSDKNLLDTFSTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPE
SSSSELLTLGEGLGLDSNRGKDIGLFEVFSQQLPTAEPVDSSVSSSISAEEQFELPLELP
SDLSVLTTRSPAVPSQSHSRLAVISESSLSSSGERSMLALSAAESAEKRVAVTEKPASSE
GEPALLSPRVDPSPEGHMTPDPFIQGHMEADHIASPPCGQVEQNHGAGQDLTRNTGTPAL
QVPASPTLPLQNPKYGPNSTESPGPSQISNAAVQTAPHHLKAAAEKLLVVNQNMQPLYVL
QTLPNGVTQKIQLTSSVSSAQGVMEASPSVLGPLGTGLALAAGLSPGLPSSQPLFPPAGK
GLLPLPHHQHLHSFSAAPQSGFPPALGSPAPPGLLIGVQQPPEPETPPRADAGPAATTPA
SGLVKKRPIARLQSRKNKKLAPSTAASSDMVSNMTLINFTPSQLPSPSGLLDLGTVGHAA
SHRTLPNIIKRSKSGVMYFEQASLLPQSVGTAAAAGVGTSPPVVGPSEAGPLATGPVPGL
SSTPPVLNVVPMQTSAVPSAGTPVPGHAAGRGSVALSSPGPQGVSELGPLSSLLVKASQQ
GLGLPEQHTGVPPPGSSVFPQLGTSGVCVLPPAHPLGAPIDPEGSYQPPATSGLGGRGDL
APPLSSFPPLVGVSDTAAAPEQSKPPPPLAAHSHSASPGGSLPADQPAPLKAKLKAKRLQ
PSADSRASGKKHKTSHPWTTAPEKHTPHHGATAAAQDSSSGVGIPAPKAHAEEEASRERP
SPRAPGQTASSLPEPQPAQNAASELDNADAKAAEEEEEEEEEEEGTFSSPLIFWLQQERR
RKESLAERKPKKGLVFEISSDDGFQISSESIEDAWKSLTDKVQEARSNARLKQLSFTGVS
GLRMLGLLHDAVVFLVEQLSGAKHCHNYKFRFHKPEEAKEPPVNPHGCARAEVHRRQSAF
DMFNFLASKHRQPPDYNPNEEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYR
SPIHGRGLFCKRNIDAGEMVIEYAGNVIRSILTDKREKYYDGKGIGCYMFRIDDSEVVDA
TMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAVRKIYRGEELTYDYKFPIEDASNKL
PCNCGAKKCRRFLN
NT seq 11385 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagcggtcggtggcgcttcccggcccggccgggcactggcgcctggggccgc
cgcgggctcgggggctgccgcgtgcgggcggctttctgggccctggccactggcgatcct
gtccagaagaaaccggatgaacagttcctaggttttggctcagatgatgaggccaaagga
cagagtcccaccaaatcttccacagtcaagtctagtgcacggaaaccacgtgggagaccc
agaaacatcttggaccaaagttcacctgtgctttccaagtcctccttaacgtattcccct
ccaagcaaaccagaactcacatcagcggaaaaagtgaagaagaaagaactgaaaagtgga
gaaaagagacgagggaggcctcctgcactcgccagcatgaagttcaaaatcagccacatg
aagggcacaccagatgctcagaaggggggcaaggaggaaaaggaggctctcaagaaggta
aagcgggccccatccacagcttttcagcatgccacaaaaatcaagaagctaagagcaggc
aaactctccccactgaagtccaaattcaaatccggcaaacttcagattggaacagagagt
tcccagctggagaaagcccagaggatcaggaaggagaaagatggcgtgccactgctcccc
aaagaagacaagcctgcggtcaggcagagcccccgcaggatcaagccagtgcggatcatt
ccttcctccaagaggacagacgccaccattgccaagcaactcttgcagaaggcgaaaaag
ggggcccagaagaagattgagaaagaagcggccaagctgcagggccggaaggcaagaact
cagctgaagaacatccgccagttcatcatgccagtggtgagtgcaatctcttcccggatc
attaaaactcccaagcgcttcattgaagatgaagactatgacccacccatcaagatagcc
cgcctggagtctacacccaacagccggttcagtgctacctcctgtgggtccagtgagaag
tccagtggtgcctctcatcactcctcacagatgtcttcagattcctcccggtccagcagc
cccagtgtcgatacatccaccgattctcaggcttctgaagagatgcaggcgctttctgaa
gagtgcagcaatactccggaggtcgttccctcttcgttgcctgtctcccagtctcctgag
aatgagggtggtgagaggaggaggaggaggaggttttcagtggcagagcgaagttttggg
cccaaaattgctaagaagctgcccagcctccagagcctctcgcagcagcagccctcctct
gcctctccccccccaccgctcctcacccctccccctcccctccagccagcagccagcgtc
tctgagcacgccccatggctcatgccccccaccattcctttggcatcaccctttctgccg
tcctccgctgcacccatgcaagagaaacggaagtccatccttcgtgagccgactttccgg
tggacctctctcaagcattctaggtctgaacctcagtacttttcctcagcaaaatacgcc
aaagaaggtctcatccgcaaacccatatttgataacttccggcctcctccgctgaccccg
gaggatgttggctttgcctctggcttctcagctcccggtgccccagctccgacgcgctta
ttttctcctctgcactccgggacaaggtttgatctccacaagaggagccctctgttgcga
gccccaagattcactccaagcgaggcccactcacgcatctttgagtccgtaaccttaccc
tcgtctgttagtcgagctgccggaggagccgctgcaacgtccgtctctttgaggaagcgg
aagaggagggtgttcagcccaattcgacctgagcccagatctccatcacactccatgcgg
acgagaagcgggcggctgagcgcctcggagctgccggctcacccgtccccatcgtccgtc
ccttcgtcgcttgcaagcatttctgtcggttccttgaccaccagtgccttaaacgccagc
ttcactttccctacccattccctttcccagcctggggaatcggtagagaagagtcagcga
ccaaggaagcagccgggggtccccgccgagcccttctcgtccagcagccccgctcccctc
ttcccctggttcccacccagctcccacacggagagggggaggaacaaagacagagcctca
gaggagccctccaagggcaaggaaagcgaccggagtgtggagaaggagaagagccgggag
agagacagagagagggagaaagaaaacaagcgcgagtcgcggaaggagaagaggaggaag
gctcccgaaatccagagcagctccgctctgttcccgggggctcgcgtttccaaagggaga
gtggctgtcagcgaagaccccgccatctcctcctctgccaaaaaggccgtggggcgcaag
aagtcgacaggcactgacctcgtggccgatgggcctgccgtggtgctggtggactcggca
acggccatcaagaccaagatggccaagagaggccggggagggctggagaaggccagcctg
gacctcggccttccagcccccgcagcggggaaggaagacgggctcaggctgcccgcagct
tcctccatcagctccgtgctggcccatgcagacaagatgccgatgacggacaagagggtg
gccagcctcctcaagaaggcgaaggcccagctgtgcaagatcgagaagatcaagtctctc
aagcaggtggaccagccaaagggacagggtcaagagagtgattcatcagaggcctcggtg
agagggccgcgcatcaagcatgtctgcaggagagcagccgtcgcacttgggcgcaagcga
gcggtcttcccggacgacatgcccaccctgagtgccttaccgtgggaagagagggagaag
atcctgtcttccatggggaacgacgacaagtcctccgttgctggttcggaagaggccgag
ccccaggtgccgcccatcaagcccatcaagcccgtgaccaggcacaagccccccccagaa
cctcccgtaaagaaaggccggcgctcaaggcgctgtgggcagtgtccgggctgccaggtg
ccggaggactgcggtgtctgtaccaattgcctggataagccaaagtttggggggcgtaac
attaaaaaacagtgctgcaagatgaggaagtgtcagaatctgcagtggatgccctcgaaa
gcctatctgcagaagcaagccaaagctgtgaagaagaaagagaagaagtccaagtccagc
gacaagaaagagagccatgctgggaagagccagtcggagtctgggcagaaagcggcccca
cagcccgtcctggccagagaggagcaccccgcaaagagaggcagcgagcctgcccggaag
cccagtgaggagaagagcgaggaggggcccccaccagccccaccagaccacagacaggcc
cctccgcctgctgccaggaaagccggaaagcaagtgccggcgccctccccaccaccacct
agttcgtgcccaccaaggagggaagcccctaaaagcatccctgcggagcccaagaagaag
cccgctctgccaccagaggcaggcatagagcaaaacaagcaaaagaaaatcactcctcgt
ccgagcttaccagtgaaacagaagccgaaggaaaaggaaaagccccctgcactcaacaag
cctgaaaacagcacactcaacatgttaaacactctgtcaaatggtagctgttccaaacag
aagcctctgacggatggagtccacaggatccgagtagacttcaaggaggactgtgaatcc
gagaacgtttgggagatgggcggtctgggtattctgacctcggtgccgataactcccaga
gtggtctgctttctctgtgccagcagcgggcacatggagtttgtgtattgccaagtgtgt
tgtgagcccttccacaaattctgcctggaggagagtgagcgccccctggaggatcagctg
gagaactggtgctgccgccggtgcaaattctgccacgtgtgtgggaggcagcatcaggcc
accaagcagctgctggagtgcaacaagtgccgaaacagcttccacccagagtgcctggga
ccaaactacccaaccaagcctaccaagaaaaagaaagtttggatctgcacgaaatgtgtt
cgatgcaagagctgtggtgcgacgacgccaggcaaagggtgggatgcccagtggtctcat
gacttctcgctgtgccatgattgtgccaagctctttgcgaaagggaacttctgccccctc
tgtgacaagtgctatgacgacgatgactacgagagcaagatgatgcagtgtgggaaatgt
gaccactgggtccactccaagtgcgaaaacctttcagatgagatgtatgagatcctctcc
agcctgccggagagcgtggcttacacgtgcactcactgcacggagcagcatcctgctgag
tggcgcctggcgctggagaatgagctgcagcagtctttgaagcaggtggtggcggccctg
ctcagttcccggacaaccagccacttgctgcgctgcagacaggcagccaagccgcctgat
ttaaaccctgagaccgaggaaagcattccgtcccgaacctctccggaaggcccggaccct
cctgtgctaacggaagtcagcaagcaggaggagcagcagcctctggacctggagggagtg
aagagaaggctggaccaaggaggctactcctctgtgctggaactgagtgatgacattgtg
aagatcatccaagcagccatgaatgccgacggagggcagccagaactcaagaaggccaac
ggcatggtgaagtctttctttattcggcaaatggaacgagtttttccatggttcaatgta
aagaaatcaagattttgggaacccaataaagtcacaaccaatagtggaatgctgccaaac
gcggtcttgcccccatccctcgaccataattatgctcagtggcaggaacgtgaagaaaac
agttgtgctcagcagccccctctgatgaagaaaataatccccgctcccaaacccaaaggg
ccaggagaaccagacttcccaacgccaccgcctccccccgcggcacccgtgtccagctct
gacagaggcagagaggacagcccagacctcgccccccctccggatgtggaagacaaccgg
cagtgtgccctttgcttgaaatatggagacgatgggacaaatgacgctggccgtctcctc
tacattggccagaatgagtggacgcacgtgaactgtgccctgtggtctgcggaggtgttt
gaggatgatgacggctccttgaagaatgtgcacatggcggtgatccgagggaaacagctg
aggtgtgagctgtgcctgaagtcgggggccacggtgggctgctgcttggcctcctgcacc
agcaactatcacttcatgtgctcccgggccaaaaactgcgtcttcctggaggacaagaaa
gtgtactgccagcgccatcgagacctgatccagggagagctacaggtggtgcctgagaag
gggtttgaggtcctgcgaagagtcttcgtggattttgaagggattagcttgaggcggaag
tttctcaatggtttggaaccagagaacatccatatgatgattgggtccatgactattgac
tgccttggaattctgaatgatctttctgattgtgaagacaaacttttccccattggctac
cagtgttctcgggtgtattggagcacaacagatgctaggaagcgctgtgtatacacgtgc
aagattgtggaatgccgccctcccacctcagagccagatatcaatagcactgtggaccac
gatgacaacaggacaatcgcacacagcccagtgccgcctcccgaaatcctcgctaatgaa
gtccatggcgtctctgcagctgtgagtcctctgtcttcagaccttcctgcgcatttgcag
aactgcaaggctctgcggatcagaaggccaagtttcgccccagtccagcgatcccccggt
tcgaggccattgccctctgcagggagccccgcccccgtgactcacgagatcgtgaccgtg
ggagacccgctgctgtcgtcgggactccttctccggagcattggccccaggaggcacagt
gcgtctcctctctcccctccgcagccccggtcctgggtgctgtctgccagcaaggccagg
gcccctctctccaggcccagcgtgggccccgccccccacgagcaggactggagcctcccg
ctgccggcagaacagtcgctgggcccggcagcctcccgcgtggctctccagagcagctct
gcccctcccagtgcccagagagcggcggtgagaagtgggagcaaaggccctccccctctg
gagggatctgtgtccttggaagtgccgcctcctggggggtccatccccacgagtgctgag
aaagccaaggttctgagtcccagagacgccagcgcttcccccaggagctccaaggccagc
cctctggtggcggcaggcacagctggcacggagccgagcaccagccaagggggggggatg
ctcctggaaacccccccgcctggattgctttcctccaaagacacggcggcttccctgcct
ttacatcagagagccccaaagaaggaacaggaccagccgatggacctcccacagccagag
ctgacctgtgcttccgaggaggcggaagggaagggctccaagacccccggcgggagtacc
aagcctcccccggccagtgagcccgttccctctgtgagcagagagaggcgacagaaaggg
aagaaagggacggcggagaggcgttccagtaagctcccgacaggttcgggtctcctcccg
ggtggcggtgagcaaagggcagggccggaacgggtcactccggcccctgagccctgcagg
gctgttgctgctgagaaggccacggagaggatctccagggcagccctttgccatggtgaa
ggaggaggagggacgccctcaaaggacctgccagcctcccagaagcgcacggtgaaggtc
accctgactcccctcaggatggagggggagagccagcccaggagcgccccgagggagagc
gacgcagggggggcctcccaggacagccagccggcttctgtggcaccgcccctgcccccc
ggggctggccctgtggcccaggagggaccacgtgaccctcccgccccggggccccaccag
agccttcctggccgagactgccccttgatactccaggagggggcggcggctaaagcaacg
gaagagggcgcctacaagcggcggtaccccaggcgcagcgcccgggccaggtccaacatg
ttctttgggctgactcccttgtacggcgtgaggtcctatggcgaggaagacatccccttc
ttcagcacctccaccgggaagaagcggggcaagaggtctgccgaggggcaggtggacggt
gcggacgacgtcagcacgtcagacgaggaagatctctactactacaattttgccaggacc
gtggtgtccggcacggaagagcacctggtgtcccacaacctgttccgagaggaggagcag
tgtagccttcccaaaatctcccagctcgatggggtggacgatgggtcagaaagtgacacg
agcatcaccgtggccgcgaggaaagtgaatccagggaccaaaagggggggcgggggcggc
aaagagaatgggacagagagcttgaaacttgataggagtgaagaaagcggagagaaagct
cacgcgacgaagatctcagccggccacaaaagtgctgacccaaagacagagaactgccgg
gccaaggctcagagccaggattccctggaagctcagctgagctccttggacgccggacgc
cggcctcgcgccagcacgccttcggacaagaatctgctggacaccttcagcaccgagctc
ctgaagtccgactccgacaacaacaacagtgacgactgtgggaacattctcccttccgac
atcatggactttgtcctgaaaaacaccccctcgatgcaggccctgggagaaagtcccgag
tcctcgtcctccgaactcctgacgctgggagaagggctcggcctggacagcaaccggggc
aaggacatcggcctcttcgaggtgttttcccagcagctgccaacggcggaaccggtggac
agcagcgtctcctcatccatctctgcagaggagcagtttgagctgcctctggagcttcct
tccgatctctctgtcctgacgactcgaagccccgcggtgcccagccagagccacagcagg
ctcgctgtgatttcagaatcgtcactctcctcgtctggggagagatctatgctagctttg
tctgctgcagaatctgcggagaagagagtggccgtcaccgagaaacctgcctccagtgaa
ggagagccggctctcttaagcccgcgagtggatcccagcccggaaggacacatgacccct
gaccccttcattcaaggccacatggaagcggatcatattgcgagtcccccatgtggacaa
gtggagcagaaccacggagccggccaagacttgacaaggaacaccgggacccctgctctc
caagtaccggcatctcctaccctccctctccagaatcccaaatatggcccaaactcgaca
gagagcccaggtccgtctcagatctctaacgctgctgtgcagacggccccccaccatcta
aaggcagcggctgaaaagctcctagtggttaaccagaacatgcagccgctctacgtcctg
cagactcttcccaatggcgtcacccaaaagatccagctgacctcctcggtcagctcggcg
cagggcgtgatggaggcgagcccttccgtgctggggcccctgggcacggggctcgcgttg
gcggcaggcctgagtcccggcttgccctcctcccagcctctcttcccgccggccggcaaa
gggctgctgcccttgccgcatcaccaacacttgcattccttttctgcagcaccccagagt
ggcttccctcctgctctcggcagccctgcccccccgggcctcctgattggtgtccagcag
ccaccggagccggaaacccctccgagagcggatgctgggcccgcagctaccacgcctgct
tccggccttgtcaagaagaggccgatcgctcgcctgcagtcgcggaagaataagaagcta
gccccttccaccgcggcctcttccgacatggtctcaaacatgactttaattaacttcacc
ccctcccagctccccagcccttcgggcctactagatctgggaaccgttggccacgcagcc
tctcacagaaccctccccaatataatcaagcgttcaaagtcaggggtgatgtactttgag
caggcgtccctgttgccccagtccgtagggaccgctgcagctgctggggtcggaacgtcc
cctcctgtcgtggggccctcggaggcaggcccccttgccaccgggcctgtgccgggcctc
agctccactccccccgtgctgaacgtggtgccgatgcagacatcggcggtgccttctgcc
ggcacaccggtccctgggcacgcggcaggacgaggatccgtggcgctgagtagccccggg
ccgcagggagtctctgagctcggccctctcagcagccttttggtcaaggcctctcagcag
ggcctgggcctcccggagcagcacacaggggtgcccccccctggctcgagcgtgtttcca
cagctgggcacctcgggtgtctgtgtcttgcccccggcccaccctctgggcgcgcccatt
gaccccgaaggctcctaccagcccccggcgacatcaggactgggcggcagaggggacctc
gcccctccactctccagcttccccccgctggtgggtgtctcggacacggcagcagccccg
gagcagagcaagcctcccccccctctggccgcccactcccactccgcttctcccgggggc
tccctgcctgctgaccagccggcccccctgaaggccaagctcaaagcaaagcggctccag
ccctcggcggacagcagagcgtcggggaagaagcacaaaacgtctcacccgtggaccacc
gcgccggagaagcacacgccccaccacggagccaccgcggctgcccaggactcctcctcg
ggtgtcgggattcctgccccgaaggcccacgcagaagaggaagccagcagagagcggccc
tcgcccagggcgccagggcagacggcatcgtctctcccagagccacagccagcacagaac
gccgccagtgagctggacaatgcagatgccaaagcagctgaggaggaggaggaggaagaa
gaggaggaggagggcaccttcagctctcctctcatcttctggctgcagcaggagcggagg
aggaaggagagccttgctgagaggaagccaaagaaagggctggtttttgagatctcgagt
gacgatggctttcagatcagctccgaaagtattgaagatgcctggaagtctttgactgac
aaggtccaggaggcccgctccaacgcccgcctgaagcagctctctttcacaggtgtgagc
ggactgcggatgctgggcctcctccacgatgccgtcgtcttcctggtcgagcagctctct
ggggcgaagcactgccacaactacaagttccggttccacaagccagaggaggcgaaggag
ccccccgtcaacccccacggctgcgccagggcagaggtgcaccgaaggcaatctgccttt
gacatgttcaatttcctggcttccaagcaccgccagccgccagactacaaccccaatgag
gaggaggaggaggaggtgcagctgaagtctgcccggagggccaccagcatggacctgccg
atgcccatgcggttccggcacctgaagaagacctccaaggaagccgttggtgtctacagg
tcccccatccacggccggggcttgttctgcaaaaggaacatcgatgcaggagagatggtc
atcgaatacgctggcaacgtgatccgctccatcctgacggacaagcgcgagaagtactac
gacggcaagggcatcggctgctacatgttccgcattgacgactcagaggtggtggacgcc
accatgcacggaaatgccgcccgcttcatcaaccactcgtgcgagcccaactgctattcc
cgggtcatcaacatcgatgggcagaagcacattgtcatctttgccgtgcgcaagatctac
cgtggcgaggagctcacctacgactacaagttccccatcgaggatgccagcaacaagctg
ccctgcaactgtggcgccaagaaatgccgccggttcctcaactga

KEGG   Gekko japonicus: 107112843Help
Entry
107112843         CDS       T04299                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  [histone H3]-lysine9 N-trimethyltransferase SUV39H [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107112843 (SUV39H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107112843 (SUV39H1)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107112843 (SUV39H1)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107112843 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107112843 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo AWS
Motif
Other DBs
NCBI-GeneID: 107112843
NCBI-ProteinID: XP_015269527
LinkDB All DBs
Position
Un
AA seq 414 aa AA seqDB search
MAENLKACSVCCKSSWSQLQDLCRLDKVCCPSLGITRKNLYDFEVEYLCDYMKVRDEEYY
LVKWRGYSEMENTWEPRKNLRCISILKQFHRDLEQALIRRGDKMRKNLRLLDPGITNYLV
QKAKQRQALQQWEYELNAKRNHKGRIMVENEVDLDGPPRDFVYINEYKVGDGIILNQVAV
GCECRDCLLEAVGGCCPGVSHHKFAYNELGQVKIKAGMPIYECNSRCSCGSDCPNRVVQK
GIRYDLCIFRTDNGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLF
DLDYVEDVYTVDAAYYGNISHFVNHSCNPNLQVYNVFIENLDERLPRIAFFATRSIRIGE
ELTFDYNMQVDPVNAESTRMDTNFGLMGGLTGSPKKRMRIECKCGMESCRKYLF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaagcctgctctgtttgttgcaaatccagttggtcccagctccag
gatttgtgtcgcttggataaagtatgctgcccgtccctgggcatcaccaggaaaaacctg
tatgattttgaagtggaatatctgtgtgactacatgaaagtccgggatgaagaatactac
cttgtgaagtggcggggctactctgaaatggaaaacacctgggagcctcgtaagaacttg
cgctgcatcagtatcctcaagcagttccaccgggacctagagcaggcattgatccggcgt
ggagacaagatgagaaagaacttgcgtttgcttgacccaggcatcaccaactatctggtg
cagaaggccaagcaacggcaagccctgcagcagtgggagtacgagctcaacgccaaacgc
aatcacaagggacgcatcatggtagagaacgaagtggacttggacgggcctccccgggac
tttgtctacatcaacgagtacaaggttggggatggcatcattctcaaccaggtggctgtg
ggctgcgaatgccgagactgtctgctggaagcagtggggggttgttgcccaggggtttcg
caccataaattcgcctataacgagctgggccaagtgaagatcaaggccggcatgcccatc
tatgagtgcaattcccgctgcagctgtgggagcgactgccccaaccgtgtggtgcagaaa
ggcattcgttatgacctctgcattttccggacagataacgggcgtggctggggtgtgcgc
acgctggagaagatccgcaagaacagctttgtcatggaatacgtaggagagatcatcaca
tcagaagaggcagagcgacggggccagatctatgaccggcagggtgccacttacctgttt
gacctggactatgtagaggacgtatatacggtggatgctgcctactatggcaacatttcg
cattttgtcaatcacagttgtaaccccaacctccaggtgtacaacgtcttcattgaaaac
ttggacgagcggctgccgcgcattgccttcttcgccactcgctcgatccgtattggggag
gaactcacctttgactacaacatgcaagtggacccggtaaatgcagagagcacacggatg
gacactaattttggtctcatgggaggcctgactggctccccaaagaagcggatgcgcatt
gagtgtaagtgtggcatggagtcctgccgaaaatacctcttctag

KEGG   Gekko japonicus: 107112988Help
Entry
107112988         CDS       T04299                                 

Gene name
NSD3, WHSC1L1
Definition
(RefSeq) nuclear receptor binding SET domain protein 3
  KO
K11425  [histone H3]-lysine36 N-dimethyltransferase NSD3 [EC:2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107112988 (NSD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107112988 (NSD3)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107112988 (NSD3)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107112988 (NSD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP C5HCH SET AWS PHD zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 107112988
NCBI-ProteinID: XP_015269677
LinkDB All DBs
Position
Un
AA seq 1440 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDASSDITEDGRQTPYEAALALQQGFQ
YPTPTTEDLPPLINGFPPISMYEPQAKYQSYSQYPNGSANGYGTVRNFSPPEYYQMENSN
IRPHEILEKSSPPQPPPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDL
LNEVQASEYARTKHEGRKEKRKKSSKHDSSHSEERKSHKIPKLEQEEQNRPNERLCTLSE
RPREETILLDETPPQQVSPPLPAQPVSDVKFEVGDLVWSKVGTYPWWPCMVSSDPQLEVH
TKINTRGAREYHVQFFSNQPERAWVHEKRVREYKGRKQYDQLVAEAAKQANHSEKQKIRK
PRPQRERAQWDIGIAHAEKALKMSREERIEQYTFIYVDKEPEEAFSKAKRTGVPKVEAKK
NRRSKPSPSAQPEETNEVSAVTSSPNTEVRRHSQRRQSSVEEEPPPVKIAWKTAAARKSL
PASITMHQGTLDLQKCNMSPVVKIEQVFALQNAAGNGKFIDQFVYSTKGIGNKPEIIIKG
QDKVTSISVQRNERTSSQSAASPETSSGLASSVEKKQQRRSIRTRSESEKSTEVVPKKKI
KKEQVETVPQTAVKTGLQKGASEISDSCKPLKKRSRASTDVELTSSAYRDTSDSDSRGLN
DLQGSFGKQSDSPSATADADASDVQSVDSSLSRRGSGTSKRDTVCQICESSGESLVSCEG
ECYRVFHTECLGLSSQPDGKFVCQECKNGQHTCFSCKVAGKDVKRCSVNACGKFYHEACV
RKFATAVFESRGFRCPQHCCTACSMDKDIHKASKGRMVRCLRCPIAYHSGDGCIAAGSLF
VSSHILICSNHSKRSNHSSSAVNVGFCFVCARGLIVQDHSDPLFSSYAYKSHYLLNESNR
AELMKLPMIPPSSSASKKKCEKGGKLLCCESCPASFHPECLNIEMPGGSWNCNDCKAGKK
LRYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDIGDFPVFFFGSHDYYWVHQGRVF
PYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIERNSRKPPPYKHIK
SNKVVGKVQIQVADLSEIPRCNCKPTDENPCGLESECLNRMLQYECHPQVCPAGERCQNQ
CFTKRLYPEAEIIKTDRRGWGLRTVRNIKKGEFVNEYVGELIDEEECRLRIKRAHENSVT
NFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFAVCDIPAGMEL
TFNYNLDCLGNGRTECHCGADNCSGFLGVRPKTACATANEEKAKNAKLKQKKRKIKTEQK
QMHEDNCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPFGKWECPWHQCDICGNPAASF
CEFCPHSYCKDHEKGALVASALDGRPCCSEHNPKAPVAPEYWSKIKRRLEQQNPEEESKE
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atggatttctccttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
caactcattgactcggctaacatccgccaagaggatgcttttgatgccagcagtgacatc
actgaagatggtagacagacgccatatgaagctgctcttgccttgcagcaaggttttcag
tatcctacaccaacaacagaggaccttccacccctcattaatgggtttccaccaatcagc
atgtatgaaccccaagccaaataccagtcatatagtcagtatcccaatggttcagcaaat
ggctatggcacagttagaaactttagtcccccagagtattatcagatggagaactctaat
ataaggccacatgaaattctggaaaaatcatctcctccacagccgccgccgccacctcct
ccttcagtaccccaaacggtgattccaaagaagactggttcaccagaaataaaattaaaa
ataaccaaaactatccagaacggcagggaattgtttgagtcctctctgtgtggggacctt
ttgaatgaagtgcaagcgagtgagtatgcgaggacaaaacatgaagggagaaaagagaag
aggaaaaaaagtagcaaacatgactcttcccactcagaagagcgcaaatcgcacaaaatt
ccaaaactagagcaagaggaacaaaatagaccaaatgagaggctctgcacgctgtctgaa
agaccaagggaagaaacaatactgttggacgaaaccccaccccagcaggtctctcctcct
cttccagcgcaaccagtgagtgacgtcaagtttgaggttggagatctggtctggtccaag
gtgggaacatatccgtggtggccctgcatggtttcaagtgatccgcaacttgaggttcat
accaaaattaacacaagaggtgcacgggaatatcacgttcagttttttagcaaccagcct
gagagggcatgggtacatgagaagcgggtacgagagtacaaaggacgcaagcagtatgat
cagttggtggcggaggctgctaagcaagccaatcactctgaaaaacagaagattcgcaaa
ccaaggccacagagagagcgggcacagtgggatattggcatcgcccatgctgagaaggct
ttgaaaatgtctcgggaagagaggatagaacaatacacattcatctatgtagataaagag
ccagaggaggctttttcaaaagccaagaggactggtgtccctaaagtggaggctaaaaag
aaccggagatctaaaccgtcacctagtgctcaaccagaagagaccaatgaggtttcagcg
gtaacctcctcacccaataccgaggtgcggaggcatagtcagagaaggcagtctagtgtg
gaagaagagcctccccctgtgaaaatagcatggaaaactgctgcagccagaaaatcctta
ccagcttcaataaccatgcaccagggaaccttggaccttcagaaatgtaatatgtcacca
gtcgttaaaattgaacaagtttttgctcttcagaatgctgctgggaatggaaagttcatt
gatcagtttgtttactctaccaagggtataggaaacaaaccagaaataatcatcaagggg
caagacaaggtcacttccatatcagtccagcgaaacgagcgaacctcatcacaaagtgca
gcatctcctgagacatcttctgggttggcaagttctgtagaaaagaagcaacagagaaga
tcaatacgaactcgctcagagtctgagaaatccaccgaagttgtgccaaagaagaagatc
aaaaaggagcaggtagaaacagtcccacagacagccgtgaagactggactgcagaaaggt
gccagtgagatttcagattcttgtaagcctctaaagaaaagaagtcgtgcctcaacagat
gtggaactgactagctcagcatacagagatacatccgactctgattcaaggggacttaat
gacttacaggggagctttggaaagcagtcagacagtccttctgctacagcagatgctgat
gcttctgatgtacagtctgtggattctagtttatcaagaagaggttcagggacgagtaag
agagacactgtgtgtcagatctgtgagagctctggtgagtctctggtatcctgtgaagga
gagtgctacagagtcttccatacggaatgcctaggattgagttcacagcctgatggaaag
tttgtctgccaggagtgcaaaaatgggcagcatacgtgcttttcctgcaaggttgctggc
aaagatgtcaagcgctgctctgtcaatgcatgtggtaaattttatcacgaggcctgcgtc
cgcaagtttgccacagctgtctttgagtctcggggattccgttgcccgcagcactgctgt
actgcctgctccatggacaaggatattcataaagcaagcaaaggtcgcatggtgagatgt
ttgagatgccccattgcctatcactctggagatggctgtattgctgcaggaagtttgttt
gtgtcatcccacattctcatctgtagtaaccattccaaaaggagcaatcactcttcatca
gctgtaaatgtaggcttttgtttcgtttgtgcaagagggctgatagtgcaggatcattca
gaccccctgttcagttcatatgcctataaatctcactacctactgaatgaatcaaatcgt
gctgagttgatgaaattacctatgattcctccttcttcgtcagcttccaaaaagaaatgt
gagaaaggtggaaagttgttatgttgcgaatcatgtcctgcatccttccacccggaatgt
cttaacatagagatgccaggtggctcctggaactgcaatgactgtaaagctggcaagaaa
ctacgatacaagcagattgtttgggtcaagcttggaaattacaggtggtggccagctgag
atctgcaaccccaggtctgttcctctcaacatacagggcctcaaacatgatatcggggac
ttcccagtatttttctttggttcacatgactactattgggtacaccagggcagagtattc
ccttatgttgaaggagacaaaagctttgccgaggggcaaactagtattaacaagaccttc
aagaaagcacttgaagaagcagcaaaacgcttccaggaactgaaagcacaaagagaaagc
aaagaagcacttgagattgagaggaattcgagaaaaccacctccctacaaacacattaaa
tccaataaagtagtagggaaggttcagattcaagttgcagacttgtctgaaatccctcgt
tgtaactgcaagccaacagacgagaacccttgtggcctggaatcagagtgtctgaaccga
atgctacagtatgagtgccacccccaagtttgtcctgcaggagagcgctgtcaaaaccag
tgcttcaccaaaagactctatccagaagcagaaatcataaaaacagaccggcgtggctgg
ggccttaggacagtacggaacattaaaaagggtgaatttgtaaatgagtatgttggtgaa
ctgattgatgaggaagaatgcagattgcgaatcaagcgtgcccatgagaacagcgtgaca
aatttttatatgttaactgttacaaaggatcgaataatagatgctggcccgaaggggaat
tattcacgtttcatgaaccacagctgcaatcccaactgtgaaacccagaagtggacagtg
aatggggatgtccgagttggactttttgctgtatgtgatattcctgcagggatggagtta
acatttaactacaatttggactgtttgggaaatggcaggacagaatgccactgtggagca
gataactgcagtgggttcctgggagtccgtccaaagacggcatgcgcaacagcaaatgaa
gagaaggcaaagaacgcaaagttgaaacagaagaaacggaagataaaaacagagcaaaag
caaatgcatgaggacaattgtttccagtgtggagatgggggtgaactggtcatgtgtgac
aaaaaagattgtcccaaagcgtaccacctcctctgccttaacttgacacagccacccttt
gggaagtgggaatgtccttggcaccagtgtgacatctgtggcaacccagcagcttcattc
tgtgagttctgccctcattcttattgcaaggatcatgaaaaaggggcactggtggcctca
gccttggatggacgtccatgctgttctgaacacaatcctaaggccccggtggcaccagag
tattggagcaagatcaagcgccgactggaacagcaaaatcccgaggaagagtcaaaagaa
taa

KEGG   Gekko japonicus: 107113385Help
Entry
107113385         CDS       T04299                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  [histone H3]-lysine9 N-trimethyltransferase SETDB2 [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107113385 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107113385 (SETDB2)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107113385 (SETDB2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107113385 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107113385 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBD Pre-SET
Motif
Other DBs
NCBI-GeneID: 107113385
NCBI-ProteinID: XP_015270195
LinkDB All DBs
Position
Un
AA seq 188 aa AA seqDB search
MAIKEVVSPRATGDPAGAAKAPSRLPCRRHTCSQDCLVPRPWNSYKGGNPLNLPLLCGFQ
RRHAKADLPSKTLDVVYKAPCGRSLRSFEEVQDYLLQTKCSFLFLDHFSFNTYVQVFRSY
PSRKGSVFDYDLSKGVEMTPVSFCNEVDHERLPYFKYRKTSWPRGLFLNNLSSAFLASCE
CTDGCRDA
NT seq 563 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaaggaagtggtgtctccaagggccacaggagatcctgcaggagcagcaaaa
gcaccttcaagactcccctgccggcgtcacacctgctcccaggactgtcttgtcccaagg
ccctggaactcctacaaaggtgggaaccccctgaacctgcccctgctgtgtggcttccag
aggaggcacgccaaagcagacctgccctccaagacgctggacgtggtctataaagccccc
tgcggaaggagcctgaggagtttcgaggaggtccaggattacttgctccaaacgaagtgc
agctttctgtttctggatcacttttctttcaacacttacgtccaggtcttcagaagctac
cccagccggaaaggatctgtgttcgattacgatctcagcaaaggagtggagatgacgccc
gtttcgttttgcaacgaggtcgaccacgagcgactgccttactttaagtatcgcaagacc
tcctggccccgtgggctcttcctgaacaatttgtctagcgcattcctcgcctcatgcgag
tgcacggacggctgcagggacgc

KEGG   Gekko japonicus: 107113725Help
Entry
107113725         CDS       T04299                                 

Gene name
KMT2E
Definition
(RefSeq) lysine methyltransferase 2E
  KO
K09189  [histone H3]-lysine4 N-trimethyltransferase MLL5 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107113725 (KMT2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107113725 (KMT2E)
   03036 Chromosome and associated proteins [BR:gja03036]
    107113725 (KMT2E)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107113725 (KMT2E)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107113725 (KMT2E)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107113725 (KMT2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET PHD PHD_2 Spectrin
Motif
Other DBs
NCBI-GeneID: 107113725
NCBI-ProteinID: XP_015270567
LinkDB All DBs
Position
Un
AA seq 1807 aa AA seqDB search
MSIVVPLGVDTAETSFLEMAAGSEPESVEASPVVVEKSNSYPHQLYNNSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIYSAPNFDETSSATTISTSEDGSYGTDITR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDIYLCERCQPRSLDKERAMLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTTITLTATRVTKVTEKKRKKSGEKEQNITK
CKKAFREGSRKSSRVKGSAPEIDPSESSGFGWETKIKAWMDRYEEASNNQYSEGVQREAQ
RIALRLGNGEDKKEVITSNAIFKPPVESYIQKNKKILKAAKDLPPDALVIEYRGKFMLRE
QFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHAIEDGTI
HLYIYSTQNIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRASEPTENLSTGYE
TRRKKGRKERDASKEKETQNQNITLDCEGAATKTKFPDNRQRKLSPLRLSISNNQEPDFI
DDIEERTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQALERIS
TAKTEVKSECKDAPIINDTEFVQEPAKEETATKPTPAKVTRTKQRKSFSRSRTHIGQQRR
RHRTVSMCSDIQPSSPDVEISSQHNEPENTALTAEPETETTVAEIVTEPEAPALNKCPTK
YPKTKKHLVNEWLSEKNEKPGKPTDSLSERPLRITTDPEVLATQLNSLPGLTYSPHIYTT
PKHYIRFTSPFLSEKRRRKEPVENIIGSCKKRWLKQALEEENSTVVDRFNSPSHERSRSP
TINGESKSPLLLNDSCSLPDLTTPLKKRRLYQLLDSAYSETSTPTPSPYATPTHADISSS
DPLLFATPPRIKAEDETCKNGYKPICSPVTPVIPCVHGNTMHFENISSPESSPEVKRRTY
SQEGYDRSSAAMLALGSFRNSNLTDMCLQEIKTIGYPSPRNRTDGTRQCSGEKETAADLQ
LGLEVIEQSALHQPLDTPGHDRTDSSSQLETAPCGRGTVYSTWVKSPDRTGVNFSVNSNL
RDLTPSHQLEVGGGFRVSESKCLIPDDARGMFLEAPVFCTSEDGLVAGFGRTVSSDTLMD
GSCTPLNPPQKKKVSLLEYRKRQREARKSGSKADNFSLVSMSPHAGGGGNSLSAADGYNS
SDNGEPVEREHPGSLPLPLPATDYSATSEETENSSLSKEASSEKNEPEVQWTASTSVEQV
RERSYQRALLLSDHRKDKDCDPDPENPEPTSECPSPDTSLKTCKSPLKLNKPSSPSPVAP
AQSLGRTPTKQDTQWDAAAATPEAEGATHPKPDQQPKQLTSTVEALSKNHPAQAHLRSTA
EPLSHAQKLPSAPLKLHCSPSPHVENPPKSSTPHTPVQHGYLSPKPHSQQLGSPYRSHHP
PSPQVGTPQRDSHRSFYPATTTLQPNMQQQPPSGTLFSQTSSVSYNQFRQQNLNASAPPP
PPPPPPSSTYYQNQQPPSGNLQNYSQLKSSIPPQQTVFPSGPNQALAGTACQQPVSGHHV
TSGHFLPSQTPAVAAPPPPPPPPVPGPHLVQQQSSHQQHAAAHVVGPVHAVAVAPGSHLH
SPAAGHHLPPPPPPPGPLPHLHPTHPTTGHQGLQAQHQHVVNSAPPPPPPPPSNVLGSGH
HVASAQGLHHPSHQGPPLFPSSAHSTVSSYPSQPPHHTPLGPGPQHQPAGTGPHGPLPGQ
GPHLQPQGPNSIPTPTASGFCPHPGSVSLPHGVQGPQQASPVPGQIPIHRAQVPPTFQNN
YHGSGWH
NT seq 5424 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtggtcccactgggggttgacaccgcggaaacttcatttttggaaatggct
gcaggctcagaacctgaatctgtagaagctagccctgtggtcgttgagaagtcaaacagt
tatccacaccagctatataacaacagctctcaccattcccacagttatattgggttgcct
tatgcggatcataactatggcgctcgcccccctccaacacctccagcttctcctcctcca
tcagttcttataagcaagaatgaagtaggcatatatagtgctcccaattttgatgagacc
tccagtgctactactatcagcacatctgaggatggaagctatggaacggacataaccagg
tgcatttgtggatttacacatgatgatggatatatgatctgttgtgacaaatgcagtgtt
tggcagcacattgactgtatggggatcgataggcagcatattcctgacatctacctctgt
gaacgttgtcaacctaggagcttggataaagaaagggcaatgttgctgcagcgtagaaaa
agggaaaatatgtcagatggggataccagtgcaacagaaagtggtgatgaggtccctgta
gaactatatacagcttttcaacacacaccaactacaattactctgactgctacacgagtt
accaaggttacggaaaagaaacggaagaaaagtggggagaaagaacaaaacatcacaaaa
tgtaaaaaggcttttcgtgaaggttctcggaaatcgtcaagagttaagggctcagctcca
gagattgatccttctgaaagttcaggctttggatgggaaactaaaatcaaggcatggatg
gatcgttatgaagaggcaagcaacaaccagtacagcgaaggtgttcaaagagaggctcaa
agaatagctttgagattaggaaacggagaggacaaaaaagaagttatcaccagcaatgca
attttcaagcctccagtagagagctatattcaaaaaaataagaaaatcctaaaagctgcc
aaagacttgcctccagatgcgctggtgattgaatatcgaggaaagttcatgctgagagaa
caattcgaagctaatggatatttctttaagaggccatatccctttgttctgttctattct
aaattccatgggctagaaatgtgcgttgatgcaagaacctttggaaatgaagctcggttt
attagacgttcttgtacacctaatgctgaggttagacacgccattgaagatggaaccatt
catctttatatctactccacccaaaacattccaaaaggaacagaaataacaattgcattt
gattttgattatggaaattgcaaatacaaagtggactgtgcttgcctcaaagaaaatcca
gagtgcccagttcttaagcgagcctctgagcctacggaaaacctcagtactggttatgaa
actagaaggaagaaaggcagaaaagaaagggatgcttcaaaagaaaaggaaacccaaaac
cagaacatcaccttggattgtgaaggagcagccaccaaaacgaagtttccagacaacaga
cagagaaaactttctccccttaggctttccatctcaaacaatcaggagccagattttatt
gatgatatagaagagagaactcctattagcaatgaagtagaaatggaatcagaggagcag
attgcagaaaggaaaaggaagatgaccagagaagagcggaaaatggaagcaatccttcaa
gcttttgcccggttagaaaagagagagaaaagaagagaacaggctttggaaagaatcagt
acagctaaaacagaagttaagtctgaatgcaaggatgcaccgatcatcaatgacaccgaa
tttgttcaggaaccagcaaaggaggaaactgccaccaagccaacccctgccaaagtcact
aggacaaaacaaaggaaaagtttctctcggagcagaactcatattgggcagcagcggaga
cgacacagaactgttagcatgtgttcagatatccaaccgtcctctcccgatgtggaaatt
agctcacagcacaatgaacctgaaaacactgcacttacagctgagcctgaaacagagaca
actgttgctgaaatagttactgaaccagaagccccagcacttaataaatgccctactaaa
taccctaaaacaaaaaagcacttggtgaatgagtggttaagtgagaagaatgagaagcca
ggcaaaccaactgacagcctttcagaaaggcctctgcgtataacgacagatccggaggtt
ttggccacccagttaaattcgttacccggtctcacttacagcccacatatctatactact
cctaagcactatattcgttttacatcaccgttcctttcggaaaagaggaggcggaaagaa
cctgtggagaacattattggctcttgtaagaagcgttggttgaagcaagcactggaagaa
gaaaactcaacagttgtagataggttcaattcaccatctcatgaacgatctagaagtcct
acaatcaatggtgaaagtaaaagccccctgttgttgaatgacagctgctccttaccagac
ctcaccacgccactaaagaagcggagactgtatcagctgttggattctgcctattcagaa
acctccacgcctactccttctccatatgccacaccaacccatgctgatatctcttcctca
gatcccttgttgtttgctactccacctagaataaaagcagaagatgaaacctgtaagaat
ggttataagcccatttgctctccagttactccagtgattccctgtgttcatggaaataca
atgcactttgagaacatttcttcacctgaaagttcccctgaagttaagaggcgaacatat
agtcaagagggatatgatcggtcatcagcagcaatgttggcacttggctcctttcggaat
tccaacctaacagatatgtgcctgcaggaaataaagactattggatatcctagtccgagg
aataggactgatggaaccaggcagtgctccggagaaaaagaaacagctgcagacctccag
ttgggactcgaagtaattgagcaaagtgcactgcatcaaccattggatacccctggccat
gataggactgattcaagcagccaactggaaactgctccatgtggacggggaacagtttac
tccacctgggtaaagagtcccgataggacaggtgtaaatttctctgtgaattctaatttg
agggatttaacgccttcacaccagttggaagtaggaggtggattccgagtgagtgagtcc
aagtgcctgattccagatgatgcaagaggcatgttcctggaagcgcctgttttttgtact
tctgaagatggacttgtagctggctttggaaggactgtcagtagcgacaccctgatggat
ggcagttgcacacccctgaatcctccacaaaagaaaaaggtgtcacttctagaataccgt
aaaaggcagcgagaagccagaaaaagtggctcgaaggctgacaacttttcgcttgttagc
atgtcacctcatgctggtggtggaggaaacagccttagtgctgctgatgggtataacagc
agtgacaatggggagccagtggaacgggagcacccgggaagtctccctctgcccctgcca
gccactgattacagtgccacttctgaagaaacggaaaattcctctttgtcaaaagaagct
tcaagtgagaagaacgagccagaggttcagtggactgcttcaacttcagtggagcaagtg
agagagcgaagttatcagcgagcattgcttctaagtgaccaccggaaagacaaggactgt
gatcctgatcctgaaaaccctgagcccacaagtgaatgtccatccccagatacttctctg
aagacttgcaagagtcctttaaaattgaacaagccttcctcaccgagtcctgtggctcct
gcccagtctctggggagaacacctacaaagcaggatacccagtgggatgctgcagcggct
actccagaggctgagggcgcaactcaccccaaacctgaccagcaacccaaacagctgaca
agcaccgtcgaagcactttcaaaaaaccacccagcccaggcccatttgcgtagcacagca
gagcctctctctcacgcccaaaagctgccttctgcaccattgaagctacactgttcccct
tcacctcatgtagaaaaccctcccaagtcctctactcctcacacacctgtccagcatggc
tacctttcaccaaagcctcattcacaacaattaggatcgccatatcggtctcatcatcct
ccgtcacctcaagtcggaacacctcagagagactctcacagaagtttttacccggcaacg
acgacccttcagcctaacatgcagcagcagccgcccagcgggacgctcttttcccagact
tcttctgtatcttacaatcaattccgccaacaaaatctcaacgccagtgccccacctcca
cccccacccccacccccttcctctacttattatcaaaaccagcagcccccctcaggaaat
ctgcaaaactacagtcagttaaaaagtagcataccaccccaacaaactgtgtttccctct
ggaccaaatcaagcccttgccggtaccgcatgccagcagccagtttcagggcaccatgta
accagtgggcattttttgccatcacagactccagctgttgctgctcctccaccgccgccg
ccacctcctgtgcctggaccacatctcgtgcagcagcaaagctctcatcagcagcatgca
gcggcacacgttgtagggccggtgcatgctgtagcagtggctcctgggtcacacctccat
tctccagctgctgggcatcatctcccaccccctcctcctcctcccggtccccttcctcac
ctccatcctactcaccccacaacaggtcaccaaggtttgcaagcacaacaccagcatgta
gtcaattcagctcctccgccaccacctccaccaccctccaacgttttaggttctgggcat
catgtggcatcagcacaaggactgcaccatccatctcatcaggggcccccgctttttcct
tccagtgctcactcaacggtctcctcctacccgtcacagcctccacaccatactccgttg
ggacctggacctcagcatcagcctgctggaacaggcccccacggtccactcccagggcag
ggtcctcacctccagcctcaaggaccaaacagtattccaacaccgacagcgtcagggttc
tgtcctcatcctggctctgtctccctccctcacggggtgcaaggacctcagcaggcatct
ccggtgcctgggcaaatacctattcacagagcgcaggtgccaccaacttttcagaacaat
tatcatggttcagggtggcattaa

KEGG   Gekko japonicus: 107115893Help
Entry
107115893         CDS       T04299                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  [histone H3]-lysine4 N-trimethyltransferase SETD1 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107115893 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107115893 (SETD1B)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107115893 (SETD1B)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107115893 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     107115893 (SETD1B)
    COMPASS/SET1 complex (yeast)
     107115893 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 107115893
NCBI-ProteinID: XP_015273155
LinkDB All DBs
Position
Un
AA seq 2006 aa AA seqDB search
MSFKEIKAGEKAKHTEDHGKKQSSSWINGMESSSQASTSAEKRNHHCKSYKLIIDPALKK
GQHKLYRYDGQHFNIPNSGLAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLLDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGEKRMHFYELLVNGLYTPQTLPVENEPDASPTVNETLQLAD
TLKRLKDSSLSSVGSSVTPNSSTPFSHDTAFSSCRQDTPNSFSQFTPQSQGTPLTPRVGT
PFSQDSAYSSRQTTPSYHFRQDSGYKPRRHETKFTDAYNRRPGHHYVHNSAGAFRGSEHQ
FSTFKSHQQETVQYSHTPPLSHSGSSTYKSAFSPYQAPTTFPQPEEPPLPQASREVEYQR
PPLPPEESPVKSSTATTPEFVPVKEKPEEPPPLPESNSLSEPAVVPFSQTPERSETPGTP
TLESDVQHNSLDSRIEMLLKEQRTKLYFLSEHDSDNEIRMEGSPISSSSSQLSPIATFGS
SSQPGHRPQTPSSRPSSTGLEDISPTPLPDSDDDEPVLGTASLCQNSRGTSDTSMTPVDQ
LCRTSKTESSETKEMLPGNQSPVSEKMDECHQSSGEDMEISDDEMNQSPITSAECAKNIV
MNTSVNSSAVMAPSIPMPPPGYPPLPPPPPHQPGFPMPPPLPPPPPPPTHTTVTVPPPPL
PAPPGVPPPHILPPLPPFMFPVMQMDMISVLSNQWGGMSMSFQMQTQMLSRMMQGHNTYQ
YHPFMGNRMQFVNLPPYRHFSMGAAIGRGQPWPPLPKFDPSVPPPGYEPKKEDPHKATVD
GVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGENKDEEKP
KPKDRITSCLLENWNKGEGLGYEGIGLGIRGAIRLPSFKVKRKEPPEAASAGDQKRIRPS
PSVDDEDEESERDRDLPDATSDLSKKDADGVGLRRRPARPLELDSEGEEEDSGKEEEEEE
SSSEKEAEQEEEEGVMKSVSDKEEEEEHANEEEEEEEEEDDDAEVETSEKEEEQDSEEED
IGSPASSRAEVESSDESDESSEFGTSSDSDEDEEEEEEEEEEEEEEVEEDYDEGGSMEQE
REAVPTEITVEPLAQEPEDEDEKETILELFPVEDDVYMQGVPLAQVEPSVPEGEELKEEA
QQVEEESGEVPEESLAAEVLMVMERTEEEKLQQSPACLPVEEPEPDTELEREVLDSPKPE
SQEEENFRPPTPVGLFGEVSSSKNSFFTKSEDSRLEAQAKSNLQPAVEEEQQQQHPRTPG
RDVLAHMDSSVLPVHPVPPCSLPLPSVGSMKEEPLLLPDKFPEQITVTKPSVEEELPRTP
GRDILARCSHSLSKSQSTDTVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSQSPGIASG
IPRTPGRDFTFTPTFPEPGATHPCLLSVKKLSEDEPDEKVFKEPLGASLLVGMNSVPSPI
PFASPPVPAFHTHIDLSPNKQLPLSVRPCLFMDSKMSLEECSTEGRSLLPFPEVPATSPP
LPPSLPPSSSVLPVRRKPGRPKRASPLGPVLDAYSGKPLEPPLLPIPVALTESAVSKELL
SGHPDAFYSLKDPEAVTLDFRNDSFHDKVAPEVFAEKLPFKELENQWNEDFKEEDAHLKS
KRQWRRQKKRPEDVPTVPSPEYSPHRYHFRPRSEFEEMTILYDIWNGGIDDEDIHFLCVT
YDHLLQQDNGMDWLNDTLWVYHPSTSFLTPKKKKRDDGMREHVTGCARSEGYYKIDKKDK
LKYLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFN
QLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGS
SYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQYINVNEEIT
YDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6021 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaagagatcaaggcaggagagaaagcgaagcacaccgaagaccatggcaaa
aaacagagttcaagctggatcaacggaatggagagcagctcccaagctagcacctctgcc
gagaaaaggaatcaccattgcaaaagttacaagttgattattgacccagctttgaaaaaa
ggacagcacaaactctatcgttacgatgggcaacattttaacattcctaactctggtctt
gccccagtggattgtgtcagagatcccaggataggacgaatatggaccaaaaccaaagag
ctggagctttctgtccctaaatttaagattgatgaattctacgtggggccggtgcctccc
aaacaagtcacgtttgccaagctgaatgacaatatccgtgagaacttcctcctggacatg
tgtaaaaaatacggtgaagtggaagaagtggagatcctctacaaccccaagaacaagaag
caccttggaattgccaaagtgatctttgccacagtcaaaggggcccgggaagcagtacag
cacctgcacaacacttctgtcatgggcaatatcatccacgtggaactggatacaaaaggt
gaaaaacgtatgcatttctatgagctacttgtaaatggactctacactcctcagaccctt
cctgtagaaaatgagccagatgcttcacccactgtgaatgaaactctgcagttggctgat
accctgaaacgcctaaaagacagcagcctttcctccgtgggatcatcagttaccccaaac
agtagcaccccattttcccatgatacagccttctccagttgtcggcaagacaccccaaac
tctttcagccaatttacccctcagtcccagggaacccctctcaccccacgcgtggggact
cctttttcccaagactcggcatactctagtcgtcagacgacaccatcttaccatttcaga
caggactctgggtataagcccaggagacatgaaacaaaatttaccgatgcctacaataga
cgtcccggccaccactacgttcataattctgcaggtgcttttcgaggttcagagcatcaa
tttagcacgttcaagtcccatcagcaagaaacggtgcaatattcccacactcctcctttg
agtcactcggggtcttcaacgtacaaatcggccttctccccgtaccaagcaccaaccacg
tttcctcagcctgaagaaccgccccttccccaagcatccagagaagtcgagtaccagcga
cctccactgcctcccgaagagtcgcccgttaaaagcagcactgctaccacccctgagttt
gttcctgtgaaggaaaagcctgaggagcccccgcccctcccagagtcgaacagtcttagt
gagccagctgtggtacccttctcacagactccagaaaggagtgagaccccgggcacccca
accctggaatctgacgttcagcataacagtttggactcgaggattgagatgctcttgaaa
gagcagagaacaaagctctattttctcagtgagcatgactcggacaacgagattcgaatg
gaaggaagtccaatctcttcttcctcctcccagctttccccaatcgcaacatttggttcc
agctctcagccgggtcacaggccacagaccccatcctcgcgtccttccagcactggcttg
gaggacattagcccaacgccgttacccgattccgatgatgatgagccggttcttggaacg
gcttctctctgccagaattcaagagggacatcagacacaagtatgactcctgttgaccag
ctatgtaggacttctaaaactgagtcctctgagactaaagaaatgctgcctggtaaccag
agtccggtatcagaaaaaatggacgagtgtcatcagtcttcgggggaggacatggagatc
tcggacgacgaaatgaaccagtctcccatcacaagcgcagaatgtgccaaaaacattgtg
atgaatacctcagtcaacagctctgctgtgatggctccttccatccccatgcccccgccc
gggtaccctcccctgcctccgccacctccacaccagcctggcttcccgatgccgccgcct
ctccctcctccgccacctccgccaacgcacacgacagtcactgtcccgcctcctcccctt
cctgcgcctcccggggtccccccgcctcatatcttgcctcccctccctccgttcatgttc
cctgtcatgcaaatggacatgatcagtgtcctgagcaaccagtgggggggcatgtcgatg
tctttccaaatgcaaacccagatgttgagccgcatgatgcaagggcataacacgtaccag
taccaccctttcatggggaaccggatgcagtttgtgaaccttcctccctaccggcacttc
tccatgggagccgcgattggccgtgggcagccctggccacctttgcccaagtttgaccct
tctgtccccccgccgggctatgagcccaagaaggaagatccgcacaaggccactgtggat
ggcgtcctcttggtgattgtgaaggaactaaaagcaatcatgaaaagggacttgaaccgg
aagatggtggaggtggtggccttcagggctttcgatgactggtgggataagaaagaacgt
ctggcaaaggcatccctcactccggtaaaatctggagagaataaagatgaggaaaaaccg
aaacccaaggatcgcatcacatcctgtctcctggagaactggaataaaggagagggtctg
ggctatgaagggattggcctgggtatccgaggggccatccggctaccatctttcaaggtg
aagcgaaaggagccacctgaagctgcctcagctggagaccagaaaagaatccgcccctcc
ccttcagtggatgatgaagatgaagaatctgaacgagaccgagacctgccagacgcaacc
tccgacctctccaagaaggatgcagatggtgtcggcctccggcgaagacccgcccggcca
ctggaactagacagtgagggagaggaggaagattcgggcaaagaggaggaggaggaggaa
tcctcttcagaaaaggaggcagagcaggaggaagaggaaggagtgatgaaatcagtgtcg
gacaaggaagaggaagaagaacatgctaatgaagaggaggaagaagaggaggaagaagat
gatgacgctgaagtggaaacaagtgaaaaggaagaggagcaggattctgaagaggaggat
atcggaagccctgcctcctccagggcagaggttgagtcgtctgatgaaagtgatgaatcc
tcagaatttggaacgagttctgattctgatgaagatgaagaagaggaggaggaggaggag
gaggaggaggaggaggaagtggaggaagattatgatgaaggggggtctatggagcaagaa
agagaagccgtacccacagaaataacagtggagcctcttgcacaagagcctgaggatgag
gatgagaaggagaccattctggaattgtttccagtagaagacgacgtgtacatgcagggg
gttcccctagcacaggtggaaccttctgtgccggaaggagaggaactaaaggaagaagcc
caacaagtggaggaggaaagtggcgaggtgcccgaggaatctcttgctgcagaagtgctg
atggtgatggagcgtaccgaagaggagaagctgcaacagtcccctgcctgcctaccagtg
gaggagcctgaaccagatacggagctggaacgtgaggtgctagacagtccaaagccagaa
tctcaagaggaggaaaacttccgtccaccaacaccggtggggctctttggagaggtctcg
tccagcaaaaactcgtttttcaccaagtctgaggacagccgcttagaagcccaagcaaaa
agcaacctgcagcctgcagtggaggaagagcagcagcagcagcaccctcggactcctggg
cgggatgtcctggcccacatggactcttctgtacttcctgtccaccccgtgcccccctgt
tcacttcccctcccgtccgttgggtccatgaaagaggaaccgttgctccttccagacaag
ttccccgaacagataactgtgaccaaaccatcagtggaggaagagctccctcggactccc
gggcgggacattttagccaggtgctcccacagtctttccaagtcccagagcacggacacg
gtcccagccacacctggcagtgatgctcctctcacaggaagcagcttgactttaagttcc
cctcaagtcccaggaagccccttttcctacccgtcacaatcccccgggatcgccagcggc
atccctcggactccggggagggatttcactttcacgcctacgttcccagagcctggtgct
acccacccttgcctcttgtccgtcaagaagctctccgaggatgaacccgacgagaaagtc
tttaaagaacctcttggtgcttccttattggttggcatgaacagtgttccctcccccatt
ccctttgccagccctcccgtcccggctttccacacgcacattgacttgtctcccaacaag
cagttacctctttctgtccggccttgcctattcatggactcgaagatgtctttagaagag
tgtagcacagaaggaagatctcttttgcccttcccagaagtccccgctacgtccccacct
ctccctccatcgcttcccccatcctcgtccgtcctgcctgtcagaaggaaacctggtcgg
ccaaaaagggcgtctcctctgggccctgtgttggatgcctattccggcaagcccctcgag
ccacctctcctcccaatcccagttgccttgacggaaagtgctgtgagcaaagagttgtta
agcggccacccagatgcattctactccctaaaagacccagaggctgttaccttggatttc
aggaacgacagcttccatgacaaggtggcaccagaggtcttcgctgagaagctccccttt
aaggaactggagaaccaatggaatgaggacttcaaagaagaagacgctcacttgaaatcc
aaaaggcagtggcggcgccagaaaaagaggccggaagacgtcccgactgttccttctcct
gaatattccccgcatcgatatcactttaggccccgctccgagtttgaggagatgactatt
ttgtatgacatatggaacgggggtatagatgacgaggacatccatttcctgtgcgttaca
tacgatcacttgttgcagcaagacaacgggatggactggctcaacgacaccctttgggtg
taccatccctcaaccagctttttgaccccaaagaaaaagaaacgggacgatgggatgcga
gaacacgtgacaggctgtgcccgaagcgaaggctattataaaatcgacaagaaggacaag
ctgaaatacctcaacaacagccgtgcgtttgctgaggaacctccagctgacacacaggga
atgagcatccccgcccagccacatgcttccacccgggctggctcggagaggaggtcagag
caacgccggcttctgtcgtccttcaccgggagttgcgatagcgacttgctcaaattcaac
caactcaagttccggaagaaaaagctaaaattctgtaagagccacattcacgactgggga
ctgtttgcaatggagcccatcgctgctgacgagatggtgatcgagtacgtgggccagaac
atccggcaggtcattgccgacatgcgagagaaacgctacgaggatgaaggcattgggagt
agttatatgttccgagttgatcatgacactattatagatgcaaccaagtgtggaaacttt
gcccgatttattaatcacagttgcaatccaaattgttatgctaaagtcatcacggtggag
tctcaaaagaagatcgtcatctactcgaagcagtacatcaacgtgaacgaggaaattacc
tatgactacaaattccccattgaggatgtcaagatcccctgtctttgtggctcagagaac
tgcagagggaccctgaattaa

KEGG   Gekko japonicus: 107118801Help
Entry
107118801         CDS       T04299                                 

Gene name
EHMT1
Definition
(RefSeq) euchromatic histone lysine methyltransferase 1
  KO
K11420  [histone H3]-lysine9 N-trimethyltransferase EHMT [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107118801 (EHMT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107118801 (EHMT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107118801 (EHMT1)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107118801 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 107118801
NCBI-ProteinID: XP_015276658
LinkDB All DBs
Position
Un
AA seq 1320 aa AA seqDB search
MATVDAERALLGKGETRRENCMKAELLKDITNNKEEGFNAMAADESAIEKQVGEPKMAPD
GETNGSCERNETKSHPSAAKNSQDNLKASLGDSAAKLSRIAENGISERDSDTGKQNHIKA
NDFTQTSVTGSNGYILSKQMAQEPPVRTTSSAFASLTGHAAKTLPAGASKGRTLGTLSQT
QAVSPAKFRVGGKDMEAKRTTAANANFKVHRARKTMPKPTSSLNASKDPKEAKAPKEDGN
KHVLEFGKPPPLPSVLGLHSSLPQNQSYVAASKSQTAASVSRKKKRRMGTYSLVPKKKTK
VLKQRTVIEMFKSISHASAGGKDEKGDASPHVNGESLEVDSEEEDSDELEEEDERGTEHP
SAFPAEDNQTAKDEAAEASKVRKMVDGESEEDPDSGESGEDEEDGDESDLEGGKTELTVT
ETGCKPRSPTALKGAIQSSESSLKKKLMKRKGKTDSPWVKPTRKRRRRSKKKQSSILGSE
MYKPPLGSGEGAGQENNMEYMEVSLDSLDLRVKGILSSQSEGLSNGPEAMEADSLQEVPL
CSCRMETPKSREITTLANNQCMATESVDKELSRCTNHVLKYELMRPSNKVQLLVLCEDHR
GRMVKHQCCPGCGFFCAEGTFMECQPESSISHRFHKDCASQVKGMSYCPHCGEEASKAKE
VTVAKADTTSTLSLTYEQKKPGTSEGRADTTTGSGTQPLEEGQPESLPAEGFDLAGTSAF
PKPAPPGMPQGPVKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGID
PNFKMEHQHKRTPLHAAAESGHVDICHMLIQAGANIDNCSEDQRTPLMEASENNHLEAVK
YLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDVNCQDDGGWTPMIWATEY
KHVELVKLLLAEGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGDSPL
HIAARENRYECVVLFLSRGSDVTLKNKEGETPLQCSSLNSQVWVALQMNKTLKESTPEKP
VQMEKTLSRDISRGYERIPIPCINSVDSEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCV
CIDNCSSSKCMCGQLSMRCWYDRDGRLLPEFNMAEPPLIFECNHACSCWRTCRNRVVQNG
LRARLQLYRTRKMGWGVRSMQDIPSGTFVCEYVGELISDAEADVREEDSYLFDLDNKDGE
VYCIDARFYGNISRFINHLCEPNLIPVRVFMSHQDLRFPRIAFFSSRPIQAGEEIGFDYG
ERFWDIKGKYFSCQCGSPKCKHSSAALAHRQASMSSSSQEAPENGLPDTSSAAAVAPAPF
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atggccacagtggatgctgagcgagctctgctgggtaaaggagagaccagaagagagaac
tgcatgaaggctgagctgctgaaagatatcaccaacaataaggaggaaggatttaatgct
atggcagcagatgagagtgccatagaaaaacaagtcggggaaccaaagatggccccggat
ggcgaaaccaacgggtcctgcgaacgcaacgaaaccaagagccaccccagtgcagctaaa
aactctcaggacaatctcaaagcgagcctaggggactccgcagctaagctgagcaggata
gctgagaatggcatttcagagagagacagcgacacagggaagcagaaccacataaaagca
aatgacttcacgcagacttctgtcacagggagcaatgggtacattttgtcgaagcaaatg
gctcaggagccgcccgtaaggactaccagcagtgcttttgcttccctcactggccatgct
gcaaaaaccctccctgcaggagccagcaagggcagaactcttggcaccctttctcagaca
caggctgtctcaccagccaagttcagggtgggtgggaaggacatggaggcaaaaagaacc
acagcagcaaatgccaacttcaaggtccacagagcccggaagacgatgcccaagcccact
tctagcctgaatgcaagtaaagaccccaaagaagcaaaagcacctaaggaagatggtaac
aaacatgttttggaatttgggaagcccccacctttgccctctgtccttggccttcattca
tctctacctcagaaccagagctatgtggccgcctcaaaatcacagacagctgcttcagtg
tctcggaagaaaaaacgaagaatgggaacttacagcctggttcccaagaaaaagaccaaa
gttttaaaacagcggactgtgattgagatgtttaagagcataagccatgcttctgcaggt
ggcaaggatgaaaagggtgatgctagtcctcatgtgaacggggaaagcttagaggtggat
tctgaagaggaagattcggatgagctagaggaggaagacgagcgtgggacggagcatcca
tctgcctttcctgcagaggacaaccaaactgctaaggatgaggctgcagaggccagcaaa
gtcagaaagatggtcgacggggaatctgaggaggacccagactctggagagtcaggagaa
gatgaggaagacggcgatgagtctgacttggaaggagggaaaacggagctgacggtcacc
gagactggctgtaaaccgaggagccctactgcacttaagggtgcaattcagagctcagag
tccagtctcaagaagaaactgatgaagaggaaagggaagacagacagcccatgggtgaaa
cccacccggaagaggaggcggaggagtaaaaagaaacaaagcagcattttaggttccgaa
atgtataagccgcctttggggagtggagaaggagctggacaggagaataacatggaatac
atggaggtgtctctggattccttggatctccgagtaaagggaattctatcttcgcaatca
gaaggtctttcgaatggccctgaagcaatggaagcagacagtcttcaggaagtgcctctc
tgtagctgccgaatggaaaccccaaaaagccgagagatcaccacgctagccaacaaccag
tgcatggcgacagagagcgtggacaaggagctgagccgatgcacaaatcacgtgctgaaa
tacgagctgatgcgcccgtctaacaaagtccagctcttagtgctgtgtgaggaccacaga
gggagaatggtgaaacaccagtgctgcccgggatgtggcttcttctgcgcagagggcacg
ttcatggagtgtcagcccgagagcagcatctcccaccggttccacaaggactgtgcctcc
caggtcaaaggcatgagctactgtccacactgtggggaggaggcctccaaggccaaagaa
gtgacagtcgccaaggcagacactacctccaccctttcactgacctacgagcagaagaaa
ccagggacttcggagggaagggcggacacaacgacagggagtggcactcaaccccttgag
gaaggccagccagagagtttgcctgcagaggggtttgatttggctggaacctctgccttt
cccaagccagccccacctggaatgccccagggacccgttaaagaaaccctcgaaagcgcc
ttgattgccctggactccgagaagcccaagaaattacggtttcatccaaagcagttgtat
ttctctgcacggcaaggggagctgcagaaggtcctccttatgttggtggatgggattgac
cctaacttcaaaatggagcaccagcataagaggactcctcttcatgcagcagcagagtct
gggcacgtggacatttgccacatgctgatccaggctggcgctaatatagacaactgctcc
gaggaccagagaaccccacttatggaagcatcagagaacaatcatctagaggctgtgaaa
tacctcatcaaggctggagcacttgtagaccccaaggatgcagaaggctctacgtgtctg
catctggcagccaagaaggggcattatgatgtggtgcagtatctcctatccaacgggcag
atggatgtcaactgccaggatgacggaggctggacgccaatgatctgggcgacggagtac
aaacacgttgagctggtgaagctgctgctcgccgaaggatcagatatcaacatccgtgat
aacgaggagaacatttgtttacactgggctgctttttcgggatgcgtggacatagcagag
atcttgctagctgcaaaatgcgacttacacgcagtgaacattcacggagattcccccttg
cacattgcggcccgagagaaccgctacgagtgtgtagtcctcttcctgtcccgcggctca
gacgtcactctgaagaataaggagggcgagactcccctgcagtgttcaagtctcaactct
caagtttgggtagctctacaaatgaacaagaccctcaaagagtcgactcctgagaaacct
gtccagatggaaaagacactgagcagagacatctcccggggttacgagcggatcccaatt
ccgtgcatcaattccgtggacagtgagccttgtcctagcaactacaaatacgtttctcag
aactgtgtgacttcccccatgaatattgacagaaacatcactcatttgcagtactgtgta
tgcatagacaactgctcctccagcaaatgcatgtgcggccagttgagtatgcgctgctgg
tacgaccgggatggtcgcctcttgcctgaattcaacatggccgagccacctttgatcttt
gagtgcaaccacgcctgctcgtgctggaggacttgccggaatcgtgttgtgcaaaatggg
ctcagggctcgattacagctttatcggacaaggaagatgggttggggtgtgcgatcaatg
caagacattccatcggggaccttcgtgtgcgagtatgttggagaactgatttctgatgca
gaggcagatgtacgtgaagaggactcctatctttttgaccttgacaacaaggatggagag
gtgtactgcatagatgcccgcttctatggcaacatcagccgcttcataaaccatctctgt
gagccaaacctcatccccgtgcgagtgttcatgtcccaccaggacctgcgttttcccaga
atcgccttcttcagcagcagacccatccaagcaggagaagagattggatttgactatggt
gagaggttctgggacatcaagggcaagtatttcagttgtcagtgcggttcccccaaatgc
aagcactccagcgccgccctggctcaccggcaagcaagcatgtcgtcgtcgtcccaggag
gcaccagagaacggactccccgacaccagctccgccgctgccgtggcgcccgccccgttt
tga

KEGG   Gekko japonicus: 107119301Help
Entry
107119301         CDS       T04299                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2-like
  KO
K18494  [histone H3]-lysine9 N-trimethyltransferase SETDB2 [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107119301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107119301
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107119301
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107119301
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107119301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107119301
NCBI-ProteinID: XP_015277253
LinkDB All DBs
Position
Un
AA seq 381 aa AA seqDB search
RLMSRAGSRPAEAGVREAKEEDAGSGDRSRALSPKKRKADSACSDSEVEFVQTTDSGERR
SLPVESESRLMSRAGSRQAEAGVREAKEEDAGSGDRSRALSPKKRKADSACSDSEVEFVQ
TTDSGERRSLPVESESQPNVIQTSSCNDQNWSDGGIKRPQTRTSVLQSRRRKLGITDATS
SEDEGPVCHSLARRRLDMGTTKGGKKPSVQGEFREQATAGLSDAEADHPGQSPLPSPSLP
CKPLGQDEGSGDKQPMSIFRTDGASEEESGSGRQELAREEAAERKASTPKQFDREDLCLL
DATKEGNVGRFLNHSCCPNLFVQSVFVETHNRNFPWVAFFTNRHIKAGTELTWDYGYLPG
SMPETEIPCQCGSHKCRKKIL
NT seq 1148 nt NT seq  +upstreamnt  +downstreamnt
gcagactgatgagcagagctggatctaggccggccgaagccggggttcgcgaagccaaag
aggaagacgcagggagcggtgacagaagccgtgccttgtctcccaagaagagaaaggcgg
actcggcctgttctgactcggaggttgaatttgtccagaccactgacagcggggagcgca
gatctttgccggttgaatctgagagcagactgatgagcagagctggatctaggcaggccg
aagccggggttcgcgaagccaaagaggaagacgcagggagcggtgacagaagccgtgcct
tgtctcccaagaagagaaaggcggactcggcctgttctgactcggaggttgaatttgtcc
agaccactgacagcggggagcgcagatctttgccggttgaatctgagagtcagcccaatg
taattcagacttctagctgtaatgaccagaattggagtgacggaggcataaaaagacccc
agacccgaacgtccgttcttcagagtcgccggagaaaactgggaatcaccgatgcaactt
cttctgaagacgagggccctgtgtgccacagtttggcaaggagacggctggacatgggaa
ccacaaaagggggcaaaaaaccaagcgtacaaggagagttcagagaacaagcaaccgctg
gactgtcggacgctgaagcggaccaccctggccagagtcctctacccagtcccagtttgc
cctgtaagcctcttgggcaggatgagggaagcggtgataagcagcccatgtccatcttca
ggacggacggtgcatccgaggaggaaagcgggagcggcagacaggaacttgctcgtgagg
aagctgcagaacgtaaggcgtctaccccgaagcagtttgacagagaggatctttgtttgc
tggatgccaccaaggaaggcaacgtgggcaggtttctcaaccatagctgctgccctaatc
tctttgtgcagagtgtgtttgttgagactcacaacaggaatttcccctgggttgcattct
tcacaaacaggcatataaaagctggaactgagctcacgtgggactatggttacttacctg
gaagtatgccggagacagagatcccctgtcagtgcgggtctcataagtgcagaaagaaaa
tcctatag

KEGG   Gekko japonicus: 107119302Help
Entry
107119302         CDS       T04299                                 

Definition
(RefSeq) PHD finger protein 11-like
  KO
K18494  [histone H3]-lysine9 N-trimethyltransferase SETDB2 [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107119302
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107119302
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107119302
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107119302
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107119302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2 PHD
Motif
Other DBs
NCBI-GeneID: 107119302
NCBI-ProteinID: XP_015277255
LinkDB All DBs
Position
Un
AA seq 287 aa AA seqDB search
MAKMLRRQCAFCPEDEECSIMYIAEGQNLAVHQDCLLYSSGFVESEEHNPENLDIRFDVA
SVVNELKRGRRLICNFCRKRGATVGCEVKTCRRSYHYFCALCDDAAIETDEVHGIYRVFC
PNHDPDRKNNLYDEDSKRERSPITVQSSSAKKKMIVKEKIAEDSLEALRKKQERQKVRVE
FLRKCKRAGLLDEIFEEMLDTLHLAQEKLMDDSTPDAVYEETVISLFDCGLFENILASAH
SASYTGTEEKIQELLETRKRLDTQIELLKDLKVILPPPEDTSSCTSE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatgttaagaagacagtgtgccttttgcccagaggatgaagaatgttccatt
atgtatatcgctgaaggacagaatctcgcagttcatcaagattgcttgttatattcctct
ggatttgtggaatccgaagaacacaatcctgaaaacctcgacataaggtttgatgtggcc
tcggttgtgaacgaactaaagagagggaggaggctgatatgtaatttctgtcgcaagaga
ggagccaccgttgggtgtgaggtgaaaacctgtcgcaggagttaccattatttctgtgct
ctgtgtgatgacgctgccatagaaacagatgaagtgcacggcatttatcgagtgttctgt
ccaaatcatgacccagataggaagaacaacctttatgatgaggacagtaaaagggaaagg
tcgcccattacagtgcagtcttcatctgctaagaagaaaatgattgtaaaggagaagatt
gcagaggacagcctggaagccttaaggaaaaaacaggagcggcagaaagtcagggtagag
tttttgaggaaatgcaagcgggccgggcttctcgatgaaatcttcgaagagatgctggac
accctacacctggcccaggaaaagctgatggacgacagcactccagacgcagtatacgaa
gagacagtaatatccctttttgactgtggcctgtttgaaaatatccttgccagtgcacat
tccgcatcttatacagggacagaggaaaaaatccaggaactactggaaacacggaaaaga
ctggatacccagatagagcttctaaaagatctgaaagtaatactgcctcctccggaagac
acatctagctgtacctccgagtaa

KEGG   Gekko japonicus: 107119617Help
Entry
107119617         CDS       T04299                                 

Gene name
ASH1L
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  [histone H3]-lysine4 N-trimethyltransferase ASH1L [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107119617 (ASH1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107119617 (ASH1L)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107119617 (ASH1L)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107119617 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET BAH Bromodomain AWS PHD PHD_2
Motif
Other DBs
NCBI-GeneID: 107119617
NCBI-ProteinID: XP_015277633
LinkDB All DBs
Position
Un
AA seq 3049 aa AA seqDB search
MDPQNTAMLGLGSGSEGFSGKSPSAVATGAAGGRRELALDGSAKEEEEKKRSCGENDGEI
GKGENLSDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKQPR
RVQKAGKMTEEKNDPGPVKQDSTKLCKKGGEPTPVECSTAEGRPRESSPHSKKPSPLHSE
ATDYGKSSLSTPVSSRDPDSKDRAQINGATTVTEKLAQLIATCPPLKSSKTKQKKPAMGV
ASEFAKDSGKKLLPTGTPTVAASKDFVKKLPGSGSMGAALANKDFAKKAPGISSGSGLIS
KDSGAKKQPGTCPSAAGLVSNKDCGKKPPVLTPPIGLISKESGRKPLVAGVPVGLVSKEC
GKRFLGSSSPIGLVNKEMSKKLVGAATPPGLVNRDLGKKLPVSGSPVGLVNKDTGKKYPG
SDSPVGLVNKDSGKKLPMTSSPSGKLPMTSSPIGLANKDCGKKLSGVTGPIGLVTKELGK
KVLGVVTPPSLALKDSGKKMAGASSPPGLTNKDSGVPKADIGNASSEPFKRFCSGSIINL
DGPEPAAPSKDSGGMKVFEKHVPRQSKESIPEKLAVQRDISGGGKEGACVQQEAPSPVER
GTADASKHDKQLPVYCTSPDFRTAGGASDLSTAKSPFSAVGEGNLPSPSPAGSVTSLTRS
PTSTLAQLTPNPLHLNSTPELLEGISEPISKSPFATDGARSAANRLSSPGSHATSKGIGW
ELNDSKVAHADTPKPSPALGKKLNLATESSIRAAIAPSVVSFSSLFNNKPILKIGAMTAL
GKSCHGADSPSSRGDSQTKPLKKRKGRKPRWTKVVSRSACRSPKGLELGRPDLFKNISCS
VLSNSSLDQAKLFKNTGSPSFAEHEFVKHQLPKLNKSGGMQSLDLLSSVDKESSKFYSPH
MQTSSGCISDDLFPEMYKSKRGRSKSKEMPHLEGPPKRTLKIPASKVFSVQSKEEQEPPV
LHPEVEIPSLRQSLSEHAFPKKRGRPKRQIRSGVKMKPPVLSVAPFVMSDNSDMLEPESD
QQPSEDFFEMSDPLGDPEELGETNACNAPELEVEPDRKETRRNNGQLMKTIIRKINKMKT
LKRKKFLNQILSSTVVEPNKGKVQSKLHTTVSTLAATFSSKLGQQINVSKKGTIYIGKRR
GRKPKSILNGILGSSASLSVLEKSAQQAGGAVLGQAVPPLLTSAANNSEILPSPVCSQSS
GVSGGQSPVSSDMGFVEPNSVPYLHLHSRQGSVVQTLAMRKASKARRRLSPPTLLPNSPS
HMSELSSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGPKKRRHSFDHISL
VPPETSTVLSGLKEKHKHKCKRRSHDYLAYDKMKRQKRKRKKKYPQLRGRQDPDFLAELE
ELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFYTHPTFPLDPLHYIRKPDLKKKRGR
PPKMREAMAEMPFMHSLSFPLSGTGFYPSYGMPYSPSPLTAAPIGLGYYGRYPPALYPPP
PSPSFTTPLPPPSYMHTGHLLLNPAKYHKKKHKLLRQEAFLTASRAPLLSMSTYHPSVPP
EMAYGWMLEHKHRHRHKHREHRSSEQPQVSMETLAANGSSRTVLESLKRYRFGKETVGER
YKHKEKHRCHMACPHLSPSKGLLGREEQWVRREPAESSSLSLGLQTPLQIDCLDAPPSLP
LGRFTPSSEPASSDEHTNLFTSAIGSCRGSGSSGTGGRKKLSDSSGLFSPQEAPLSRPTR
KETLPPMEKALTTLPGSLPAQEKPSQRPTETTSCSPSRKRSSSESTSSTVVGIPARSTRL
GSTMEDSVDNLLQHMAQHESQAALDKTLEAVMANTPAPPSRSPSRSPSREKSGGLSGPGT
LGDSAREGHPLLSDRLSGGYSPYHLKRSMVEAMQRQARKMCDYDKILATKKNLDHVNKIL
KAKKLQRQSRTGNNFVKRRPGRPRKYPLQSVVSVHSLQVSRFAGPDLDSGEKGCPLHRGP
DTVTDAIESVVQGVNVKGWKRKRWLEEEEQARKRQKPLPEEEQESDKSFPEAPAECPAPE
ETVVKPREPERVEQPPTTFVQREKKAPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEK
LEYTPGEHEYGLFPAPIHVGKYLRQKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSN
VYVDVKPLSGYEATTCNCKEPEDGDKKGCMDDCLNRMIFAECSPNTCPCGEQCCNQRIQR
HEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYC
LNLDSGMVIDSYRMGNEARFINHSCNPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDY
NFHSFNVEKQQLCKCGFDKCRGIIGGKSQRMNGLLSKTNQPVTSQRRPSRSKEKRKSKHK
LKKRKGHMHEEPSESSSTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEV
KHANDNLHSASLYTRWNGMCRDDGNIKSDVFMTQFSALQTSRSVRTRRLAAAEENLEVAR
AARLAQIFKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLATIEKQIL
TGYYKTVEAFDGDMLKVFRNAEKYYGRKSPIGRDVCRLRKAYYNARHEAAAQIDEIVGET
ASEADSSETSMCEKESGHEKDEDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVE
HYLCEQCEPRTVDREVPMIPRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDG
HPVRQSYRLLSHINRERLDIFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRKFYHNEL
FRVPLYEIIPLEAVVGTCCVLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNR
YPVCTKSYAFDHFPKRLTPKRDFSPHYVPDNYKRNGGRSSWKSDRSKSQNKDLGQEEDPL
PLMEDMIPSQEQPPSEQAPSLEEPEKEAFPQESGEADKKAEESSPAPRRPCTPEERRHMQ
RERLNQILLTLLEKIPGKNAIDVTYLLEEGSGRKLRRRTLGLPESIYRK
NT seq 9150 nt NT seq  +upstreamnt  +downstreamnt
atggaccctcagaatactgctatgttagggctgggttctggttctgaagggttttctggg
aaaagcccctctgcggttgccacgggcgcagcaggaggcagaagagagttggccctcgat
ggtagcgctaaggaggaggaagagaaaaagaggagctgcggggagaacgacggcgagatc
ggcaagggcgagaacctgtccgacgcccagcagcagttttccgtgaaggaaacgaacttt
tcagagggaaatttaaaactgaaaattggcctccaggctaagagaactaaaaaaccccca
aagaatctggaaaattatgtctgccggcctgccataaaaaccactatcaagcagcccagg
agggtgcagaaggctgggaagatgacagaggagaagaatgacccaggacctgtgaagcaa
gactcaacaaaactgtgcaagaaaggtggagaacccacgccggtcgaatgctccacagcc
gagggcagaccaagggagagcagtccgcattcgaagaaaccttcgccgttgcactccgaa
gcgaccgattatgggaagtcgtccctttctactccagtcagtagccgcgatccagactcg
aaggacagagctcagattaacggggccaccaccgtcacagaaaaattggctcagctcatc
gccacttgtccgccgttgaagtcttccaaaacgaagcaaaagaagccagccatgggggtt
gcctccgaatttgctaaagactctggaaagaagcttctgccgaccgggaccccgacggtg
gcagctagcaaggacttcgtaaagaaactacctggcagtggcagtatgggcgctgcattg
gccaacaaggattttgcaaagaaggcgccaggaataagcagtggatctgggttgatcagc
aaagactctggggctaaaaagcaaccagggacgtgccctagtgcagctggattagttagt
aataaggattgtgggaagaagccgccggtccttacccctccgataggcttgatcagcaag
gagagtggaaggaaaccactagtggctggtgtgccagtggggctagtgagtaaggaatgt
gggaaaagatttctggggtctagcagtccaatcggattggtcaataaggagatgagtaaa
aagctggtaggggctgccactccccctgggttggttaacagagacttggggaaaaaatta
ccagtgtctggcagtccagttggcttagttaataaggataccggaaagaaatacccaggt
tcagatagcccagttggtctagttaacaaggattcgggaaagaaactgcccatgaccagt
agtccaagcgggaaactgcccatgaccagtagtccaatcggtttggccaataaagactgt
gggaagaagctttcaggggtcactggtccgattgggttggttactaaagaattgggaaag
aaggtcctgggggttgtcacgccacccagtttagcgcttaaggactctggaaagaaaatg
gcaggggccagcagtccacccgggctgactaacaaagactcgggggttccgaaagcagac
attggtaatgcttcctccgagcccttcaaacgcttttgcagcggaagcatcatcaatctt
gatggtccggaacccgcagccccttcgaaagacagcgggggcatgaaagtgtttgagaag
catgttccaaggcagagcaaagagagcattccagagaagttggcagttcagagagacatc
tcgggtggaggcaaagaaggggcctgcgtgcagcaggaggctccttctcctgtggaaagg
ggcactgccgatgcatcgaagcatgacaagcagctgccggtgtattgcacttccccggac
ttcaggacagccggcggcgcttctgatctgtctacggccaaatcgccctttagcgctgta
ggagaggggaacctcccgtccccctccccggcaggctccgtcacctccttaacccgaagc
cccacttcaaccttggctcagctgactcccaacccgttgcatttaaacagcacgccagaa
ctcttagaaggaatttccgagccaattagtaagtccccatttgccaccgatggcgcacgc
tcagctgcaaacaggctgtccagccccggctcacacgccaccagcaaaggtatcggttgg
gaattaaatgactctaaagtcgcccacgcagacaccccgaaacccagccccgccctaggt
aaaaagctcaacttggcaaccgaatcaagcatccgtgccgctatcgccccttcggtggtt
agcttctccagcttatttaacaataaacccattctaaagattggtgccatgactgcactg
gggaaatcctgccacggagctgactccccaagtagccgtggcgactcccaaacaaagccc
ttaaagaaaaggaaaggacggaagccacgctggacgaaggtggtttctaggagcgcttgc
cggtctcccaaagggctagaattaggaaggcctgaccttttcaaaaacatttcttgcagc
gtgctgtcaaacagtagcctggaccaggccaagctctttaaaaacacaggctcgccttct
tttgcagagcacgagtttgtcaagcatcagttgccgaagctgaacaaatcgggtggcatg
cagtctctcgatctgcttagtagcgttgacaaggagtccagtaaattttacagtcctcat
atgcagacttccagcgggtgcatttcggacgatttgtttcctgagatgtacaagtccaaa
aggggcagatcgaaatccaaagagatgccccatttggaaggcccccccaagcgcaccttg
aagatccccgcctcaaaggtcttttcggtgcagtcaaaggaagaacaggagcctccagtg
ttgcatccagaggtcgaaatcccttctcttcggcagagcctttcggagcacgcctttcca
aagaagagaggtcggccaaaaagacagatcaggtcgggggtcaaaatgaagccccctgtt
ctgtctgtagctccttttgtcatgtcggacaattccgacatgctggagcccgaaagcgac
cagcagccgagcgaggatttctttgaaatgtcggatcccctcggagacccggaggaactt
ggggaaacaaatgcctgtaacgcgcctgagcttgaggtggagccagacagaaaagagacc
aggcgaaacaacgggcagctgatgaaaaccatcatcaggaagatcaacaagatgaagacg
ctaaagcggaaaaagttcttgaatcagatcctctcgtccactgtggtggaaccaaataaa
gggaaagtgcaatccaagctccacacgacggtgtcgaccctcgccgccacctttagctca
aaactggggcagcagatcaacgtcagcaagaaaggaacgatctacataggaaagaggcga
ggcaggaagcccaaatccatcctgaatggcatcttgggtagttctgccagcttgagtgtt
cttgaaaagtctgcccagcaagcagggggggctgtgctaggccaggcagtcccgcctttg
ctgacttctgcagctaataactctgagatccttccatcaccagtttgttctcaatcctct
ggggtgagcgggggtcagagcccggtcagcagcgacatgggctttgtggagcccaactca
gtcccgtacttacacctccactccaggcaggggagcgtggttcagacccttgcgatgaga
aaggcctccaaggccaggaggaggctctccccgccgactctgctcccaaactccccgtcc
cacatgagcgagctgagctcactgaaggaagcaaccccctcgcccatcagcgagtcccac
agcgacgagacgattcccagcgatagcggcatcggaaccgacaacaacagcacttctgac
cgggccgagaagttctgcggcccgaagaaacggcggcactccttcgaccacatctccctc
gtccccccggagacctccaccgtcctgagcggcctcaaggagaagcacaagcacaagtgt
aaacgccggagccacgactacctggcctacgataagatgaagcggcagaagcggaagagg
aagaagaagtacccgcagttgcgcggcaggcaggaccctgatttcctggccgagctggag
gagctgatcagtcggctgagcgagatccggataacgcaccggagccaccatttcatcccc
cgggacttgctgccgaccattttccgaatcaatttcaacagcttctatacccaccccact
tttcctttggatcctttgcactacatccggaagccggacttgaagaagaagcgaggccgg
ccccccaaaatgagggaggcaatggcggaaatgcctttcatgcatagcctcagtttcccc
ttgtccggtactggattctacccttcctacggtatgccttactctccttctcccctcact
gctgctccgattggcttgggctattacgggcggtacccgccagccctttatccccctccc
ccttccccttcatttaccaccccactgcctcctccatcttatatgcataccggccacttg
ctcctcaatccggccaagtaccacaagaagaaacataagctactgcgccaggaggcattc
ctcaccgccagccgggcgcccctcctctccatgagcacctaccaccccagcgtcccgcca
gagatggcctacggctggatgctggaacacaagcatcggcaccgccacaagcaccgcgag
caccgctcctcagagcagcctcaggtctccatggagaccttggcagccaacggctcttcc
cgcaccgtcctggagtctctgaagcgttaccgcttcgggaaggaaacggtgggcgagaga
tacaagcataaggagaagcaccggtgtcatatggcttgcccacacctgtccccttcgaaa
ggcctgctaggcagggaggagcagtgggtcaggagggagccagcggagtccagttcactc
tcactaggattacagacaccattgcagattgactgtttggacgctcctcccagcctgcct
ttggggcgattcacgccgagttccgagcccgccagcagtgatgaacacacgaacctcttt
accagtgcaataggtagctgccgaggctctggctcttccggtaccggcgggcgtaagaaa
ctgtccgacagctcggggctgttcagcccccaagaagcgccgctcagccgtcccacgagg
aaggagacgttgccccccatggagaaagcgctgacaaccttgccaggctcgcttccagca
caggagaagccctcgcagaggccaacagagactaccagctgcagcccttccagaaagagg
tcttcatcagaaagcacatcctctacagtggtcgggatccccgcacggagtacgaggctc
ggaagcaccatggaagattccgtggataatctattacagcacatggcccagcacgaaagt
caggctgcgctggacaaaaccctagaggccgtcatggccaacacgcccgctcccccttcc
aggagccccagccgaagccccagcagggaaaagagcggcgggctctcaggcccgggcacc
ctgggggactcggcccgcgaaggccaccccctcctctccgaccgcttgtcgggcggctac
tccccctatcacctcaagaggagcatggtggaggccatgcagcgccaggcgaggaagatg
tgcgattacgacaagatcctggccaccaagaagaacctggaccacgtgaacaagatcctc
aaagccaagaagctccagcggcagtcgcggaccggcaacaactttgtgaagcgccggccg
ggcaggcccaggaagtaccccttgcagtcggtggtctcggtgcactccctgcaagtgagc
cggtttgccggcccggacctcgacagcggggagaaaggctgcccgctgcaccgcggcccc
gacaccgtgacggatgccatcgagtcggtggttcagggggtgaatgtgaaagggtggaag
aggaagaggtggctggaggaggaggagcaagcccggaagaggcagaagcctttgccggaa
gaagagcaggagagcgacaagagctttcccgaggctccagctgagtgccctgcccccgag
gagaccgtggtaaagccacgtgagccagagagagtcgagcagcccccaaccaccttcgtc
cagcgtgagaagaaggctccccgccctccgaagaagaagtaccagaaggcagggctgtac
tccgatgtgtacaaaaccactgaccccaagagtcgcctgatccagttgaagaaggagaag
ctggagtacactcctggagagcatgagtatggattgttcccagcccctattcacgtgggg
aaatatctgcgacaaaagcgaatagacttccagctgccctacgacattctctggcaatgg
aaacacaaccagctgtataaaaagccagacgtcccgctttacaagaaaatccgttctaac
gtttatgtggacgtgaaacctctttctggttacgaggccaccacttgtaactgtaaggaa
ccagaagatggggacaagaagggctgtatggatgactgtttgaacaggatgatctttgcc
gagtgctcgcccaacacgtgcccctgcggggagcagtgctgcaaccagcggatccagagg
cacgagtgggtgcagtgcttggaacgcttccgggccgaggagaagggctggggcatccgc
acgaaggagcccctgaaagccgggcagttcatcatcgagtacctgggagaagtggtcagc
gagcaggagttcaggaaccggatgatcgagcaataccacaaccacagcgaccactactgc
ctcaacctcgacagcgggatggtgatcgacagctaccgcatggggaacgaggcccgcttc
atcaatcacagctgcaacccgaactgcgagatgcagaaatggtccgtcaacggagtctac
cggatcgggctgtacgcgctgaaggacatgcccgctggcaccgaactaacatacgactac
aacttccattccttcaacgtggaaaagcagcaactctgcaagtgtggctttgacaagtgc
agaggcatcatcggggggaagagccagcgaatgaacggcctcctgagcaaaaccaaccag
ccagtcacctcccagaggaggcccagccggtccaaagagaagaggaaatcgaagcacaag
ttgaagaagaggaagggtcacatgcatgaggagcccagcgaaagttcaagcaccccgacg
cggttgacaccacagctgcaaatgaagccgatgtccaacagggaaaggaattttgtgctg
aagcatcacgttttcctggtgcgcaactgggagaaaatccggcagaagcaagaggaagtc
aaacacgccaacgacaaccttcactccgcctcgttgtacacgcgctggaacgggatgtgc
cgggatgatggcaacataaaatccgacgtcttcatgacccagttctccgccctgcagacc
tcccgctccgtgcggacgcggcggctggctgcagccgaggagaacctggaggtggcgcga
gccgcccgcctcgcgcaaatcttcaaggagatctgcgacggcatcatctcgtacaaagat
tcctcccggcaggcgctcgccgctccgctgctgaatcttcccccgaagaaaaagaatgcg
gattactacgagaagatttccgaccctctcgacctcgccaccatcgagaagcagatcctg
acgggctactacaaaaccgtggaagctttcgacggtgacatgctgaaggtcttccgcaac
gccgagaaatactacggcaggaaatcgccgatcgggcgggacgtctgccggctccggaag
gcctactacaatgcccgccacgaggcggccgcccagatcgacgagatcgtgggtgagacg
gcgagcgaggcagacagcagcgagacctccatgtgcgagaaggagagcgggcacgagaaa
gacgaggacgtcatccggtgcatctgcggcttgtacaaagacgaaggactcatgatccag
tgcgacaagtgcatggtttggcagcactgtgactgcatgggagtgaactctgatgtcgag
cactacttgtgcgagcagtgtgaaccccgcacggtggacagggaggtacctatgattccc
cggcctcattacgcccagcccggttgcgtttatttcatctgccttttacgggatgacctc
ttgcttcgccaaggcgactgtgtgtacctgatgcgagacagccgaaggaccccggatggc
cacccggtccggcagtcatatcgcctgctgtcccacatcaaccgagagaggctcgacatc
ttccgtattgaaaaactctggaaaaatgaaaaagaggagcggtttgcatttggccaccac
tatttccgtccgcacgaaacgcaccactccccctcccgcaagttctaccacaacgagctg
ttccgggtgccgctgtacgagatcatccccttggaggcagtggtggggacctgctgtgtg
ctggatctctacacctattgcaaaggacggccaaagggagtgaaggagcaggacgtctac
atctgcgattaccgcctcgacaaatcggcccatctcttctacaagatccaccgcaaccgc
tatcccgtgtgcaccaagtcctacgccttcgaccatttccccaaaaggctcaccccgaag
agagacttctcgcctcattacgtaccagacaactacaagagaaacgggggcagatcatct
tggaaatccgaccgctccaagtcccagaacaaagacctcggccaagaggaggaccccctt
cccctcatggaggacatgatcccaagtcaggagcagccacccagcgagcaagcgcccagc
ctggaggagccggagaaggaggcgttccctcaggaaagcggcgaggcggacaagaaggcg
gaggagagcagccctgcccccaggcggccgtgcaccccggaggagcgccgacacatgcag
cgggagaggctgaaccagatcctcctcaccctcctagaaaaaatcccagggaagaatgcc
attgacgtcacctacttgctggaggaaggctcggggcggaagctgcggcggcgcacgctg
ggtctcccagagagcatctaccggaagtga

KEGG   Gekko japonicus: 107119624Help
Entry
107119624         CDS       T04299                                 

Gene name
EZH2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  [histone H3]-lysine27 N-trimethyltransferase EZH2 [EC:2.1.1.356]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107119624 (EZH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107119624 (EZH2)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.356  [histone H3]-lysine27 N-trimethyltransferase
     107119624 (EZH2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107119624 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     107119624 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC CDC45
Motif
Other DBs
NCBI-GeneID: 107119624
NCBI-ProteinID: XP_015277638
LinkDB All DBs
Position
Un
AA seq 772 aa AA seqDB search
MFRTALSGPVCDFRKGGVIMGQTGKKSEKGPICWRRRVKSEYMRLRQLKRFRRADEVKSM
FNSNRQKIQERTEILNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPKQVIPLKTL
NAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDR
ECGFINDEIFVELVNALGQYSDDDDDDEDDDDDDDDDNLDGRNDKQKNQESNRLDKESHP
PRKFPSDKIFEAISSMFPDKGTSEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQR
EQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPHCYQHLEGAKEF
AAALTAERIKTPPKRPGGRRRGRLPNNTSRPSTPTINVLESKDTDSDREAGTETGGENND
KEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAI
ARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSS
NHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCY
LAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQK
NEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPN
CYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggacggcattgagtggaccggtgtgcgatttcaggaagggaggggtaatcatg
ggtcaaaccggaaagaaatctgagaagggaccaatttgctggaggaggcgtgtaaaatca
gaatatatgcgacttaggcagctcaagagattcagacgggcagatgaagtaaagagtatg
tttaattctaatcgtcagaagatacaagagaggacagaaatcttaaatcaagaatggaaa
cagcggcggatacaacctgtacacatcatgacttctgtgagctcattgcgtgggaccagg
gagtgctctgtcaccagcgacttagattttccgaaacaagtcatccctctgaagactctg
aatgctgttgcctcggtgcccataatgtactcttggtctcccctacagcaaaattttatg
gtagaagatgagacagttttgcacaacattccttatatgggagatgaagtgcttgaccag
gatggaacatttattgaagaactaatcaagaattatgatggaaaagttcatggggacagg
gagtgtgggtttatcaatgatgagatatttgtggagttggtcaatgctcttggccagtat
agtgatgatgacgatgatgatgaagatgatgatgatgacgacgatgatgataatcttgac
ggaagaaatgacaagcagaaaaatcaggagagcaacagactagacaaagaaagccatcct
cctcgtaaatttccttctgacaagatatttgaagccatttcatcaatgtttccagataag
ggtacatcagaggaactgaaagaaaagtacaaagaacttacagagcagcagcttccaggg
gctcttcctcccgaatgcacaccaaacatagatggaccaaatgccaaatctgttcaaagg
gagcaaagtctgcactcctttcacaccctcttctgcagacgctgtttcaaatatgattgc
ttcttacatccattccacgcaactccaaacacttataaaagaaaaaatacagagacggca
ctagataataagccttgtgggccacactgttaccagcatttggaaggagccaaagaattt
gctgccgctctgactgctgagcgaataaagacgccaccaaagcgccccgggggccgccga
agggggaggctccccaacaataccagccggccgagcacgccaactataaatgtgctggaa
tctaaggataccgatagtgacagagaagctgggactgaaaccggaggagaaaacaacgat
aaggaagaggaagagaagaaggacgagacttcaagctcctcggaagcaaattctagatgt
caaacgccaatcaagatgaagccaaatattgagcctcctgaaaacgttgagtggagcggt
gcagaagcatcaatgttcagagttctcattggtacctattacgacaatttctgtgcaatt
gccaggttaattgggaccaaaacgtgtaggcaggtgtacgagtttagagtaaaggaatct
agtattattgctcctgcacccgctgaagatgtcgatactcctccaagaaagaagaagagg
aaacacagattgtgggcagctcattgcagaaagatacagctgaaaaaggatggatcgtcc
aaccatgtttacaactaccagccctgcgatcacccccgtcagccttgtgacagctcatgc
ccctgcgtcattgctcagaacttctgtgagaagttctgtcagtgcagttcagaatgccaa
aacaggtttcctgggtgccgctgcaaagcacaatgcaacactaagcagtgcccttgctat
ttggctgtgcgcgagtgcgatccagatctctgcttaacatgtggcgcggccgatcactgg
gatagcaagaacgtctcttgcaagaactgcagtattcagcgaggatccaaaaagcatttg
ctgctagcgccttccgatgtggcaggctgggggattttcattaaggatcccgtgcagaaa
aacgaattcatctctgagtattgtggcgagattatttcacaggatgaagcagacagaaga
gggaaagtgtacgacaagtacatgtgcagttttctgttcaacttaaacaatgattttgta
gttgatgcaacacggaagggtaacaaaataagatttgcaaaccattcagtcaatcccaac
tgctatgcaaaagttatgatggttaacggagatcacagaataggcatatttgctaagaga
gccattcagactggtgaagagctgttttttgactatagatacagccaggctgatgccctc
aagtatgtaggcattgaaagagaaatggaaatcccttga

KEGG   Gekko japonicus: 107120098Help
Entry
107120098         CDS       T04299                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  [histone H3]-dimethyl-L-lysine36 N-methyltransferase [EC:2.1.1.358]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107120098 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107120098 (SETD2)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.358  [histone H3]-dimethyl-L-lysine36 N-methyltransferase
     107120098 (SETD2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107120098 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 107120098
NCBI-ProteinID: XP_015278226
LinkDB All DBs
Position
Un
AA seq 2333 aa AA seqDB search
GKAENVQKPGFVKGPVFKGVASSRFLPKGTRTKVNLEEQGRQKVSFSFSLTKKTLQNRFL
TALGNDKQNETSSSPAAPPQTDLASKIKIDLGDFSGATEEFSLPKPKVELGKIHFKKHLL
NVTTKPSPAVVALPTVALTPTVLAEVVEVPSSPPPPPPPPPPPPPPPTLLVPVPILSPAA
FPPVPIAVPTVASPPSPSPVETAVRMTTESSNYASQETLQQSTTQNTVSDGSEEHLAPVI
SVEAEIAPAKGESRVGKEEEVLDSSKGAFPSSKKHSSKRKSDGTLPASESDEDSVRTSSS
QRSHEIKISTSLEKEKDSRKSSTSLKTDEQTKSSSRSRSDRDEKYSSYSRSERDSRYSSS
HSRSDRGRRRSRSRSRSRSERGSRTGSSYSRSERSHYYDSDRRYHRSSPYREKTRYSRSY
MDSRTRESSDSEEEYRRSYSRSTDTRRTSSHSSSYRDSRTSSYSKSDRDSKIESSHTDSE
RKGKPTKSDRESKRISESEVSRRYSPVSEVGHRKGTSHSKADSSVTSSRHKSTSSKSSSA
PKTDKCKSSFCCTESEEIREQSNCVDSEAPCVQNCEAETITQKPESERIVSVLSQLNDSP
TFKKLGESKESSPISKSVELAGMDSHDSIKEGESLVTVKHDNLRNCSPVELNINVSPEDK
PRDVTLSCTSKVEVVAMSSDDSLDSSDVPLRVKSPSLGEVSSNGLQTACLSKGHDLDDSP
VLSCESNSLLKEKKVLVLSEYEFVPSCIVNLNHSKILPKVDDLTDPGNKTKDPAPCYLSE
DATPSLYYSEVEIEAEPSDTKAIQESLTDVHVEPQTETCSYVEDHNLLKTDVEDQNLSKT
VTESEKCVARSFSFSESSPVRDASVEEHPMEVKLDNQFIAQQPPSENVFSRLERTLQKKR
EELVECPAVALEIDAQHVDPIVEKTKSPVKNEHSYYLEMPIEDLEKEEPNGGEDVVALEE
RTTSDVKDCCPEASMMKDKDDSLVESVFSEALSPSCDIVVTVEETEMLAEAPGCDSSGST
PELIRNEEYSDTAESASEPGSEESETDDSDSDDSSVPRNRLQSVVVVPKNSTISMEESSS
SSSRNSQSSRRYSDHWEDGRPESSKPYYEEIQDDMESDNGPQYETKCVTSRGAEGSPATS
MEHGRAEPEILQLGVSQPQSDGVDSTSQTELASDSVSKPKLDERTALAAPVSVVQSPRQE
ELRYFDKDYELGDNTCRQQASVSKPDSRQGKLGFGDQADTGEDFSREEGFHSAEDLGTLG
WDFSQLEKPSSTYQQPDSSYGIFPGYVYPPGSGPYVASHNYWQDNGYWDPRLSNRPPGMH
YERIQGQVPDSLTEDHEEYEEVDCWVDESQPYFPNQSSKFQARDPREKGSVQAPEISSNS
AKEPVAVSERKDYVKTLSQSDMKERGPLKKRRQDLESDSGSDGDSRERKKVKTESEQVPV
LLRESSMVRPLCVMEDFRDPQRWKEFAKQGRMPCYFDLIEENVYLTERKKNKSHRDIKRM
LCECPTLSKDERAQGEVACGEDCLNRLLMIECSSRCPNGDSCSNRRFQRKQHADVEVILT
EKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARSKNIHYYFMALKNDEIIDA
TQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQK
CFCGSTNCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLS
LSRLMVRIETLEQKLTCLKLIQVRFNPSEVESAFKLQATYGNPLIDADVILVASIAGNGC
RSGRIPLFLAGDDREVYRIPKKSQVEKETSAERGRETTGRDPAATPKNLSRERDPERRSQ
SKEKKKRRDSLSPPSAYERGTKRPDDRQRRKLFEQEVAQREAQKQQQQLQSLGMASPLPY
DSMAYSTSHHTFMGYPPGYPMQSYVDPTNPNAGKVLLPTPSMDPMCSPAAYEQPQALVGH
TIEPTLAAPQPVPVVQHVATTLEVSTPQYVAQTDPVVHQEQSVTVLPVPAPAPVQGQSYS
VWDSGQQTVAVQPPYSPAQSQPAIYYQGQACQTVYGVTSPYSQTTPPIVQSYAQPGLQYI
QGQQIYAAHPQGVMVQPTTAVTTIVAAGQPPPIQQPELVVTNNLLDLPPPSPPKPKTIVL
PPNWKTARDPEGKIYYYHVVTRQTQWDPPTWDSPGDDTSLEHEAEMDLGTPTYDENPMKS
SKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARK
LTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGGIYKPKEDTDLE
NT seq 7002 nt NT seq  +upstreamnt  +downstreamnt
ggcaaggctgaaaatgtccagaagcctggctttgtcaaagggccagtgttcaaaggagtg
gcatctagccgtttcttgcccaaaggcacccgaacgaaagttaaccttgaggagcaaggc
aggcaaaaggtgtcctttagcttcagtctaaccaagaagaccttgcagaacaggttcctg
acggcccttggaaacgacaagcaaaacgagacttcgagttccccggctgcaccgcctcaa
actgacctggcttccaaaattaaaattgatcttggggatttttctggagctacagaggaa
ttttcactaccaaaaccgaaggtagagttaggcaagatccatttcaagaaacatctgctg
aacgtgacgaccaagccttccccagctgttgtggcattgccaactgtggctctcactcca
actgttctagcagaagtggtggaggtgccctcatcgccccccccccccccccccccccct
ccgccacccccacctccaccaacactacttgtcccagtacccatactgagcccagcagct
tttccaccagttccaattgcagtaccgacggttgcttcgcctccgtcgccatcacctgtc
gaaactgctgtccgaatgacaacggagtcctcaaattatgcatcacaagaaactttgcag
caaagtactacacaaaatactgtgtcggatggctcagaagaacatttagctccagtcatt
tctgtggaagcagaaatagcaccagcgaaaggagagtcccgtgttgggaaggaggaggag
gttttggacagttccaagggcgctttccccagttctaagaagcatagttcgaagaggaag
tctgatggcacgttgccagcttctgaatcggatgaagattctgtgaggacttcctcaagt
cagaggtcccacgaaattaaaatatcaactagcttggagaaagaaaaagattcacgaaag
agctctacttctctcaaaactgatgagcagacaaaatcttcatcacggtctagatcggac
agagatgaaaaatattccagttactccagatctgagagagactccaggtactcttcgtcc
cattccagatctgaccgagggaggaggcgaagcagatctcgttctcgttctagatctgag
agaggttctagaaccggttcttcttattccagatctgaacggtctcattactatgactct
gaccgaaggtaccataggagctcaccatatagagaaaagacacgatattctcgttcgtac
atggatagcaggacaagagaaagttcagattcagaagaggagtatcggaggtcatattcc
agatcgacagatacaaggcgtacatcctctcattcctcatcttacagagactctaggact
tcttcctattccaagtctgatcgagatagcaagatagaatcctctcacaccgactcggag
agaaaaggaaagcctacaaaatcggaccgggaatccaagaggatttcggaaagtgaagta
tcaaggaggtactctccagtgagtgaggtgggacatcggaagggaacatcccactctaaa
gcagacagcagtgtgacttcttcccgtcacaagtccacctcttccaagtcatcatctgct
ccaaagacagataaatgtaaaagttctttctgttgtacagaatctgaggaaatcagagag
cagtctaattgtgtagactcagaggcgccttgtgtgcagaactgtgaggcagaaactatt
acacagaagccagaatcagaaaggattgtttcagtgttaagtcagttaaatgattcacct
actttcaaaaagctaggtgaatcaaaagagagttctcctatttcaaagtctgttgaactt
gccggaatggatagccatgacagtattaaagaaggggagtctttagtcacagtaaaacat
gataatttaagaaattgttctccagtagaactgaatataaatgtgtcgccagaagacaag
cccagagatgtgacattatcctgtacctccaaagtggaggtagttgcaatgtcttctgat
gatagcttagatagttccgatgtaccacttcgggtcaagagccctagtttaggtgaagtg
tcatctaatgggcttcaaactgcgtgcctttctaaaggacacgatctagatgattccccc
gttctttcttgtgaatccaacagtttgcttaaagaaaaaaaagttctggttctttctgag
tatgaattcgttccctcctgtattgtgaatttaaatcattctaaaatattacctaaagtg
gatgacctaaccgatcccggtaataaaaccaaagatccagccccttgctacctttcggag
gatgccactccgtcgttgtattattcagaagttgaaattgaagctgaaccttcagataca
aaagctattcaggaatctcttacggatgttcatgtagaaccacaaacagaaacctgcagc
tatgttgaggatcacaatttgttaaaaactgatgttgaggatcaaaatttgtcaaaaact
gttactgaaagtgaaaaatgtgttgctagaagtttcagcttctcagagagtagcccagtg
agagatgcttctgtggaagagcatcccatggaagtgaaattagacaatcaatttattgca
caacagccaccttcggaaaatgtattctcccggttggagagaactttgcagaaaaagagg
gaagaactagtagagtgtcctgcagtagctcttgaaatagatgctcagcatgttgatccc
attgtagaaaaaacaaaatcccccgttaaaaatgagcattcttattatttagagatgcca
atagaagacctagaaaaagaggagccgaatgggggggaggatgtggttgcccttgaagaa
cgaaccacatctgatgtgaaagactgctgtcctgaagcctcgatgatgaaggacaaagat
gactccttggtggaatccgtattttcagaagcgttgtccccatcttgcgatattgttgtg
actgtagaagaaacggaaatgctagctgaagccccaggatgcgacagtagtggcagcact
cctgaactaattcgtaatgaggaatattccgacaccgctgaaagcgcaagcgaaccgggt
agcgaagaaagcgaaacggacgactcggattcagatgacagcagtgttccgaggaaccgc
ctccagtcggttgtggtcgttcccaagaattctacgatatccatggaggagagcagttcc
tcttcctctcggaacagccagagtagcaggcgctactcggatcactgggaagatggcagg
ccagagtccagcaagccgtattatgaagaaatacaagatgacatggagtcggacaacggt
cctcaatacgaaaccaagtgtgttacttctagaggtgcggagggaagcccggcaacatct
atggagcacggtagagcagagcctgaaatccttcagctgggtgtctcccaacctcaaagt
gatggtgtcgacagtaccagtcagacagagctggcatcagattctgttagcaaaccgaag
ctagatgaaaggacagcattagcagcgccagtatctgtagttcagtcgccgcggcaagaa
gagctgcgctattttgacaaggactatgagttgggtgataatacgtgtaggcaacaagcc
agtgtttccaagccagacagtaggcaggggaagttaggttttggtgatcaagcagacaca
ggagaagatttctccagagaagaaggcttccattcagcagaggacctggggaccttgggg
tgggacttctcgcagctggagaaaccgagcagcacgtaccaacaacctgacagcagctac
ggcattttccccgggtatgtttacccaccaggttcagggccatatgttgcatcccataac
tactggcaagacaatgggtattgggacccaaggttgagtaataggccccctgggatgcat
tacgagagaatccaagggcaggtccccgattcgctaaccgaagaccacgaggaatatgaa
gaagtggactgttgggtggacgaaagccagccttacttccccaaccagtcaagtaagttc
caagctcgtgatccaagagagaagggctccgtgcaggcgcccgagattagcagtaactcg
gctaaagagccagtcgccgtgagtgagaggaaagattacgttaagactctgagtcaaagc
gatatgaaagagcgggggcccctgaagaagcggaggcaggacttggagagtgactccgga
agcgacggggactcccgggaaaggaagaaggtcaagacagagagcgagcaggtgccagtt
ctccttcgggagtcctcgatggttcgcccgctgtgcgtcatggaagacttcagggacccg
cagcgttggaaagagtttgccaagcaagggaggatgccctgctacttcgacctgattgaa
gaaaatgtatatttaacagaaaggaagaagaataagtcgcaccgtgacatcaagcggatg
ctgtgcgagtgcccgacgctttccaaagacgagagagctcaaggggaggttgcgtgcgga
gaggattgccttaaccgcctgctcatgatagaatgttcttcgaggtgcccaaacggggat
tcctgctccaaccggcgattccagaggaagcagcatgccgacgtggaagtcatcctgacc
gagaagaaaggctggggcttgagagcggcgaaagaccttccttcgaacaccttcgtactg
gaatactgtggagaagtgctggatcacaaagaatttaaagcacgcgttaaagagtatgcc
cgaagcaagaacatccattactacttcatggcgttaaaaaatgacgagataatagatgcc
actcagaaaggaaactgctcacgtttcatgaatcacagctgtgaaccaaactgtgagaca
cagaagtggactgtaaacggacagctgagagtcggctttttcaccaccaaattggtccca
tcgggctctgagctaacgttcgactaccagttccagagatatggcaaagaagctcagaag
tgtttctgtggctccaccaactgccgaggctaccttggaggagagaacagagtcagcatc
agagccgccgggggcaaaatgaagaaggagcggtctcgtaaaaaagattcggtggatgga
gagctggaggcactcttggagaacggagaagggctttcagataagaaccaagttctcagc
ttgtcccgactcatggtgcggattgagactctggaacagaagctcacgtgtcttaaactc
atacaggtaagattcaacccatcggaggtggaaagtgctttcaagctgcaggctacttac
ggcaaccctctcattgacgccgacgtaattttggtcgcgtccattgccggcaatggatgt
cgctctgggagaatccccttattcctggcgggagatgatcgagaggtgtacaggatccca
aagaagagtcaagtggagaaagagaccagtgcagagcgagggcgagagacaacaggtcga
gacccagccgctaccccgaaaaacctgagcagggagcgagatcctgaaagacgaagccaa
agcaaagaaaagaaaaagcggagagactctctgtcccccccttcggcgtacgagcgaggc
acgaagcggccagatgaccggcaacgcaggaagctctttgagcaggaggtggcccagcgg
gaagcgcagaagcagcagcagcagctgcagagcctggggatggcctccccactcccctac
gactccatggcctacagcacctcccaccacacctttatgggctatccccccggctacccc
atgcagtcctacgtggaccccaccaaccctaacgccggcaaggtgctgctccctaccccc
agcatggaccccatgtgttccccggcggcctacgaacagccgcaggctttggtggggcac
accatcgagccaaccctggccgctcctcagccggtgcccgttgttcagcacgtagcgacg
accctggaggtgtcgaccccgcagtacgtagcgcagaccgatcccgtggtccaccaggag
cagagcgtcacagtcctcccggtgccggcccccgccccggtgcaagggcagagctatagc
gtttgggattccggccagcagactgtagcggtgcagccgccgtactccccggcacagtca
cagcccgccatttactaccaaggacaagcgtgtcagacggtttacggggtcacgtcgccg
tattcgcagaccacgccgccaattgtacagagttacgcccagccaggccttcagtatatt
caggggcagcagatctacgccgcccacccccagggtgtcatggtccagcccacgacagcc
gtgacgacgatcgtagcggcaggacagcctccacctatacagcagccggagctcgtggtg
accaacaacctcctggacctgcctccgccctctcctccgaaacccaaaaccatcgtcctc
cctccaaattggaaaacagcccgagatccagaggggaagatctattactaccacgtggtg
acaaggcaaacccagtgggaccccccgacttgggacagccccggggatgacaccagcctg
gagcatgaagctgaaatggatcttggaaccccgacgtatgatgaaaatcccatgaagtct
tccaaaaaacccaaaacggcagaggcagacacttctagcgagctggcaaagaaaagcaag
gaagtattccggaaggagatgtctcagttcatcgtgcagtgcctgaacccctatcgcaag
ccagactgcaaagttggccggataaccacgactgaagatttcaaacaccttgcacgcaag
ctgacccacggagtgatgaacaaagaactgaaatactgcaaaaaccccgaggacctggaa
tgcaacgagaatgtgaagcacaagacgaaagagtacatcaagaaatacatgcagaagttt
gggggcatttataaacccaaggaggacacggacttggagtag

KEGG   Gekko japonicus: 107121138Help
Entry
107121138         CDS       T04299                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETMAR
  KO
K11433  [histone H3]-lysine36 N-dimethyltransferase SETMAR [EC:2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107121138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107121138
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107121138
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107121138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET AWS
Motif
Other DBs
NCBI-GeneID: 107121138
NCBI-ProteinID: XP_015279494
LinkDB All DBs
Position
Un
AA seq 292 aa AA seqDB search
MDVSRGLENLPVTVWPRLEEPPGFQYSPDHVAAAECGPDPSEISFQGCSCQSASCLASMC
SCLPYAENYKNSCINYEGNELEYSKPIFECNVMCQCGESCQNRVVQRGLQFRLEVFKTAK
KGWGLRTLDFIPKGRFVCEYAGEILNFREACRRVQLQSANDSNYIIAIREHLCDGQIMET
FVDPTHTGNVGRFLNHSCEPNLIMVPVRIDSMVPKLALFADRDICAEELSYDYSGRHRNS
FPALQREQEKPQGEKLKKKPCYCGAKLCTGFLPYDGSLFCEQETTGCPKETL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgagccgagggctagagaatttgcccgtgactgtttggccgcggcttgaggag
cccccaggattccagtacagtccagatcacgtggctgctgccgaatgtggaccagacccc
tctgaaatctcctttcagggatgcagctgccaatctgcttcctgcctggcttccatgtgt
tcatgtcttccttatgcagaaaactataagaattcatgcatcaactatgaaggaaatgaa
ctagagtattcaaagcctatttttgagtgcaatgttatgtgccagtgtggagagtcatgc
cagaacagggtggttcaaaggggcttacaattcagactggaagtctttaagacggccaag
aaaggttggggtcttcgcactctggatttcataccgaaaggcagatttgtgtgtgaatat
gcaggggaaatcctcaatttcagagaagcatgtcgaagggtacagctgcagtcagcaaat
gattcaaattacataatagcaataagagagcacttgtgtgatggtcagatcatggagacg
tttgttgatcccacacacacaggtaatgttggtcggttcctgaaccactcctgtgagcca
aacctcattatggtccctgtccgcatagactcaatggtgccaaagctggcactttttgct
gatagagatatctgtgcagaagaactttcgtatgattattctggaagacatcgtaattcc
ttcccagctttgcaaagggaacaggagaagccacaaggagagaaactgaagaaaaagccc
tgttattgtggtgccaagttatgcacaggtttcttgccatatgatggttctttattctgt
gaacaagaaaccacaggctgcccaaaagaaacactgtga

KEGG   Gekko japonicus: 107121584Help
Entry
107121584         CDS       T04299                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  [histone H3]-lysine9 N-trimethyltransferase SETDB1 [EC:2.1.1.355]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107121584 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107121584 (SETDB1)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107121584 (SETDB1)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107121584 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107121584 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 DUF489 Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 107121584
NCBI-ProteinID: XP_015280003
LinkDB All DBs
Position
Un
AA seq 1260 aa AA seqDB search
MNVSAAMADSQDMVELQREVTEELGISMEELRQFIEEELEKSERVRRWKEELKNLEEYVK
QKEDEVAHVDQLLENAEKAVDKCEVLVKDVYTSLGLEYCETASDEDDASSKPMEVIEIPD
EDDDVMSVDSGDTSNKTAKDQSLLREAMAAMRKSAQDVQKFMEAVNKKSSSQGSQQVSPG
CEIMQDGDLAVGDRVLGKKRTKTWHKGTLIAIQIVGVGKKYKVKFDNKGKSLLSGNHIAY
DYHPSSENLQVGSRVVAKYKDVNQMWLYAGIVAETPNIKNKMRFLIFFDDGYASYVVQPE
LYLICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKTGQLIKTEWDGTWWKSRVEE
VDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTQEKKQGGQARTRPNVGAVRSK
GPVVQYIHDLTGTSTQFKPVEPPPVPIMVSQPVSPQFVDVDSPESQLAQSKKQQVAKKST
SFLRPGSVGSGPSSPSSPVLGEPAPVVRSGVTQQFRFSVAQPAGSTSAQQFHSVLDRMPN
EISYRAPVEKLFYLPHVCSYTCLSRVRPLYGEQYRSKNPLLIPLLYDFRRMTARRRINRK
TGFHVIYKTPCGLCLRSMGEIERYLFETDCDFLFLEMFCLDPYVLVDRKFQPYKPFYYIV
DITKGKEDVPLSCVNEIDSTPPPQVAYSKERIPGKGVYINTGSEFLVGCDCEDGCRNKSR
CACHQLTIQATACTPGGQINPHSGYQHKRLEECLPTGVYECNKRCKCNKNMCTNRLVQHG
LQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHI
ESVENSKEGYESEAKCSSDSSGVNLKDDEDENSGSEEPEESNEDSSDDNFCKDEDFSTSS
VWRSYATRRQTRGQKENGLSETASKDSGLARQVSHEEAAPCKPPLSEETSKNKVASWLSS
TMSDSFQDNDSRSSFRMHEAGDAKPVKLERADTEKAPAVGLAAKEETGPDADVKVKKKEE
PEDHSRSATTGRVYGYNPNPTVPKGVRRPLSKTAMHQSRRQSDTQPADQDVMMLSSSTDS
EGDNGRGTSGQAQGNANDSDDIQTISSGSEEEHGADEKKNSSSRLATKRQVAVKSTRGFA
LKSTHGIAIKSTNLASGENALIRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLF
VQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKKLLCCCGALECRGRLL
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttctgccgccatggcagactcacaggacatggtggagctgcagcgcgaggtg
acggaggagctgggcatctccatggaggagctccggcagttcatcgaggaggagctggag
aagtcggagcgggtccggcggtggaaggaggagctgaagaacctggaggagtacgtgaag
cagaaagaggacgaagtggctcatgtggaccagctcctggaaaatgccgagaaagccgtt
gacaaatgcgaagtgctcgtgaaagacgtctacaccagcttgggcctggaatattgcgag
accgcctccgacgaggacgacgcgtcctccaagccaatggaagtgattgagatccccgac
gaagacgacgatgtcatgagtgtggattctggcgacacaagtaacaaaacggcaaaggac
cagtctttgcttcgagaagccatggctgccatgaggaaatcggctcaggacgtgcagaag
tttatggaggcggtgaacaaaaagtccagcagccagggatcccagcaagtcagccccgga
tgcgaaatcatgcaagacggagacctggcggtgggcgaccgtgtcttgggcaagaagcgg
accaagacttggcacaaggggacgctgatcgcgatccagatcgtaggggtcggcaagaag
tacaaagtgaagttcgacaacaaagggaagagcctgctgtcgggcaaccacatcgcctac
gactatcacccgtcgtccgagaacctgcaagttgggagccgggtggtggccaagtacaag
gacgtgaaccagatgtggctgtacgccgggatcgtggccgagacgccaaacatcaagaac
aagatgaggttcctgatcttcttcgatgacggttacgcctcgtacgtcgtccagcccgag
ctgtacctgatctgccggccactcaaaaagacctgggaggacatcgaagacatctcctgc
cgggatttcatcgaagagtacatcacggcctacccgaaccgacccatggtcctgctcaag
accggccagctcatcaaaacggagtgggacggcacttggtggaagtcgcgcgtggaggaa
gtggacgggagcctggtcaagatcctcttcctggacgacaaacgctgcgagtggatctac
cggggctccacccgcctggagcccatgttcagcatgaaaacctcaaccgcctccacccag
gagaagaagcaaggggggcaggcgaggacccggccaaacgttggtgccgtacggagcaag
ggcccagtggtccagtacatccacgacttaaccggaaccagcacgcaatttaagcccgtg
gagccacccccggtgccgatcatggtgtcgcagccggtttcgccgcagtttgtcgacgtg
gacagtccggaaagccagctggctcagtcaaaaaagcagcaagtggccaagaagagtact
tccttcctgcgtccgggctccgtggggtcgggaccgtcttctccgtcttcccccgtcctg
ggcgaaccggctcctgtcgtgaggagcggggtgacccagcaatttcggttctccgtcgct
cagccggccggcagcacctccgcccagcagttccacagcgtcctggaccgtatgcccaac
gagatctcctaccgggcccccgtggagaagctcttctacctcccccacgtgtgcagctac
acctgcctgtcgcgggtgcgccccctctacggcgagcagtaccgcagcaagaaccccctc
ctcatcccgctcctctacgacttccgccgcatgacggcccgccggcgcatcaaccgcaag
acgggcttccacgtcatctacaagacgccctgcgggctgtgcctgcgcagcatgggcgag
atcgagcggtacctcttcgagacggactgcgacttcctcttcctggagatgttctgcctg
gacccctacgtcctggtggaccgcaagttccagccgtacaagccgttctactacatcgtc
gacatcaccaaggggaaggaagacgtccccctgtcgtgcgtcaacgagatcgacagcacc
ccgcccccccaggtggcctacagcaaggagcgcatcccgggcaagggggtctacatcaac
accggctcggagttcctggtggggtgtgactgcgaagacggttgtaggaacaaatccaga
tgtgcttgccaccagctgacgatccaggcaactgcctgcacccctgggggacagataaac
ccacattcgggataccagcacaagaggctggaggagtgtcttcccacaggagtgtacgag
tgcaacaagcggtgcaagtgcaacaaaaacatgtgcaccaaccgtctggtccaacacggc
ctgcaggtgcggctgcagctcttcaagacgcagaacaaaggctggggcatccgctgtctg
gacgacatcgccaagggctcgttcgtctgcatctatgcagggaaaatcctgacggacgat
tttgcggacaaagagggcctggagatgggggacgagtatttcgccaacctggaccacatc
gagagcgtggagaactcgaaggagggctacgagagcgaggccaagtgctcctcggacagc
agcggggtcaacctgaaggacgacgaggacgagaactcgggctctgaggagccggaggaa
tccaacgaggacagttcggacgacaacttctgcaaggacgaagacttcagcaccagctcg
gtgtggcgcagctatgccacccgccgccagacgcggggccagaaggagaacggcctgtcg
gagacggcctccaaggactccggcctggcccggcaggtgagccacgaggaggccgccccg
tgtaagccccccctctcggaagagacctccaagaacaaggtggcctcctggctgagctcc
accatgtccgacagcttccaagacaacgacagcaggtcttcgttcaggatgcacgaggcg
ggcgacgccaagccggtcaaattagaaagggccgacaccgagaaggccccggccgttgga
ctggcagccaaggaggagaccggcccggatgcagacgtgaaggtgaagaagaaagaggaa
ccggaggatcacagcagatcagcaactacaggcagggtgtacggctacaaccccaacccg
acggtacccaaaggagtccggaggccactcagcaaaaccgccatgcatcagagccgaagg
cagtcggacacacagcctgcagatcaggacgtgatgatgctctcgagcagcacggacagc
gagggggacaacgggcggggcacctcggggcaagcgcagggcaacgcgaacgacagcgac
gacatccagacgatctcctccgggtccgaggaggagcacggggcagacgagaagaagaac
agctcttccaggctcgccacgaagcgccaagtggccgtgaaatccacccggggcttcgcc
ctgaagtcgacccacggcatcgccatcaagtcgaccaacctggcctcgggggagaacgcc
ctcatccggaagaacacgcggcagttctacgacggcgaggagtcctgctacatcatcgac
gccaagctcgaggggaacctcggccgctacctcaaccatagctgcagccctaacctcttt
gtgcagaacgtctttgtggacacacacgatctccgtttcccgtgggtggccttcttcgca
agcaagcggatccgggccgggacagagctcacatgggattacaactacgaagtgggcagc
gtggaggggaagaagctgctctgttgctgcggagccctcgagtgccggggccgcttgttg
taa

KEGG   Gekko japonicus: 107121665Help
Entry
107121665         CDS       T04299                                 

Gene name
SMYD2
Definition
(RefSeq) SET and MYND domain containing 2
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107121665 (SMYD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107121665 (SMYD2)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107121665 (SMYD2)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107121665 (SMYD2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107121665 (SMYD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12 TPR_8 TPR_10 TSP_NTD Complex1_LYR
Motif
Other DBs
NCBI-GeneID: 107121665
NCBI-ProteinID: XP_015280117
LinkDB All DBs
Position
Un
AA seq 435 aa AA seqDB search
MRSGDNSELGLERFQSPGRGRGLRALRHFAVGELLFSCPAYTCVLTVNERGNHCECCFAR
KEGLSKCGRCKQAFYCNVDCQKQDWPMHKLECSAMCAFGQNWNPSETVRLTARILAKQKT
HPERTDSEKLLSVKEFESHLDKLDNEKKELIQNDISALHHFYSKHMDYPDNEALVVLFAQ
VNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGIVAEVRAVQEIEPADEIFT
SYIDLLYPTEDRNDRLRDSYFFTCDCGECITKEKDKDKLEIRKLNEPPSAEAVRDMIKYA
RNVIEEFRRAKHYKSPSELLEVCERSLDKMGCVFEESNVYMLHMMYQAMGVCLYMQDWEG
ALRYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLENRAAGVKALTKAIAIMEIAHGK
DHPYVIEIKKELEAH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccggggacaattccgagttggggctggagcggttccagagcccgggtaggggc
agaggtctgcgggctttgcgccacttcgccgtgggcgagctgctcttctcctgcccggcc
tacacctgcgtgctgaccgtcaacgagagaggcaaccactgcgagtgctgcttcgccagg
aaagaaggactgtccaaatgtggaagatgtaagcaggcgttttactgcaacgtagactgt
cagaaacaggactggccaatgcacaagctggagtgctctgccatgtgtgcgtttggacag
aattggaatccctctgagacggtgagactcactgcaaggatccttgccaaacagaaaaca
caccctgaaaggactgactcagaaaaactcctttctgtaaaagagtttgaatcccatctt
gataagcttgacaatgaaaagaaggagctgattcagaacgacatctctgccctccatcac
ttctattcaaagcacatggactaccctgacaatgaggctctcgtggtcctctttgcccaa
gttaactgtaatggcttcaccattgaagatgaagaactttctcacttggggtctgcaata
ttccctgatgtggcgcttatgaaccacagttgctgccccaatgtgattgttacctacaaa
gggatagtggctgaagtgagagccgttcaggagattgaacctgcagatgagatttttacc
agttacattgacttgttgtatcccacagaagatagaaatgatcggttaagagactcctat
ttctttacctgtgattgtggagaatgcattactaaagaaaaggacaaagataaactcgaa
atccgcaagctgaatgagcctccatcagcagaagctgtgcgagatatgatcaaatatgcc
agaaatgtgattgaagaattcaggagggccaaacactacaaatccccaagtgaactactg
gaagtttgtgagcgtagtctggacaagatgggctgtgtatttgaagagagcaatgtgtac
atgctgcacatgatgtatcaggccatgggagtctgtctttacatgcaagactgggaaggt
gctttacgctacgggcagaagattatcaaaccatacagtaaacattaccctttgtactcc
ctcaacgtggcctccatgtggttgaagctggggagactgtacatgggcctggaaaacaga
gctgctggtgttaaagctctgacaaaggcaattgctatcatggagatagcgcatgggaaa
gatcatccatacgttatagagatcaaaaaggaattagaggcccactga

KEGG   Gekko japonicus: 107121904Help
Entry
107121904         CDS       T04299                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  [histone H3]-lysine36 N-dimethyltransferase NSD2 [EC:2.1.1.357]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107121904 (NSD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107121904 (NSD2)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107121904 (NSD2)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107121904 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET AWS C5HCH PHD HMG_box HMG_box_2 DUF4893 zf-HC5HC2H_2 zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 107121904
NCBI-ProteinID: XP_015280402
LinkDB All DBs
Position
Un
AA seq 1380 aa AA seqDB search
MDFKSSSLLLTKKSVNHIKMKQVPEILGSATGKAQNCEVNRECSVYLGKTHLSATLQEDV
VPKYNGRDALPFIPADKLKDLTSRVFNGESGAQDTKLRFESQDIKEAGTPPNTTPAKNCS
PEIKLKITKTYMNGKPLFESSICGDNGIDISPAEENQQKTENKERRNRKRSIKYDSVLEQ
GFGGAALISKTSSPSGKKIVSEDDSTAVAGKDDRIHMLKYNVGALVWSKVSGYPWWPCMV
TTDPILHNFTKINGQKKSFRQYHVQFFGDAPERAWVFEKSLVPFKGEEQYEQLCQESAKH
SLTRAEKIKMLKPVSGKLRPQWEMGMKQAKDALSLTAEERKAKYTFFYIRGRPVLNPQVA
KEAGLAVKSLEEMDKIYTDEDISQSLKSRKESDVPTKRRRTKMAAANESEEDIKPVNASP
DKTLEEREAKRGPGSPLGRKKAVTYTPRNRKGDAVSQFLVFCQKHRDEVTAEHEDASSDE
IEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDTGSSQKSMGEAKRKVFQESPKRRSR
SRSNLHGNKRHPVKRTKEPTEEFEVQEAPRKRLRMDKKKKETSNDKTAKTNSTKVTEISS
SQKNQSGLSDACKPLKKRNRASAAESSHLAYSKSSSPSASFTENEISDGQGDERPESPYE
SADEVQAELSLLSKKADRGSAARKEYVCQLCEKPGDLLLCEGRCCGAFHASCTGLPGKSS
GRFVCGECSSGVHKCFVCKEKKSEVKRCIVSHCGKFYHETCVKKFRLTVFDNRGFRCPLH
SCASCHVTNPSNPKVFKGKMMRCIRCPVAYHAGDSCIAAGCEVINSSNIICTNHFTATKG
KSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCKAGKKIHFQD
IIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEVGEFPVFFFGSKDYYWTHQARVFPYMEG
DRGSRYQGIKGIGKVFKNALQDAEARFREIKLRREAKETQENERKPPPYKHIKVNKAFGK
VQIYTADISEIPKCNCKPCDENPCGLDSECLNRMLMYECHPQVCPAGDRCQNQCFTKRQY
PETKIIKTDGKGWGLLAKRDIKKGEFVNEYVGELIDEEECMARIKYAHENDITYFYMLTI
DKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVHGDTRVGLFAVCDIPAGTELTFNYNLD
CLGNEKTACKCGAPNCSGFLGDRPKNSSSNASEEKGKKTKRRARRRRTKSEARKKSEDYC
FRCNDGGQLVLCDRKTCTKAYHLSCLGLVKRPFGKWECPWHHCDVCGKPSASFCHFCPNS
FCKDHYDEMSLSSNASGQLFCSDHAGENFTAKKTKRAPRKLTPVKCKKRQRNKWKRTACK
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaaaagtagctccctgctgttaaccaaaaagagtgtcaatcacataaaaatg
aagcaagtaccggagatccttggaagcgctacagggaaagcgcagaactgtgaagtgaac
cgtgagtgttccgtctacttgggcaaaacgcatctttctgccacactacaggaagatgtt
gtgccaaaatacaacggccgtgatgcgctcccatttatcccagcagacaagctgaaagac
ctcacttcccgtgtgtttaacggagaatcaggagcacaagacaccaagctgcgttttgag
tcgcaggatatcaaggaagctgggacaccgcctaacactactcctgccaagaattgctct
ccagagattaaactgaaaatcactaagacttacatgaatggaaagcctctgtttgagtct
tcaatttgtggcgacaatgggatagatatatctccagcagaggagaaccagcagaagaca
gagaacaaggagaggaggaacagaaaaagaagcatcaagtatgactctgtgcttgaacag
ggctttggtggagcagcattaatctcgaagacaagtagtccctctggcaagaagattgtg
tctgaggatgattctactgctgttgctggaaaagatgacagaattcatatgctgaagtac
aatgtaggagccttggtgtggtccaaagtatctggctatccatggtggccgtgtatggtg
acaacagatcctatccttcataacttcacgaaaataaatggtcaaaagaagagctttcgc
cagtatcatgtacagttcttcggagacgccccagaacgagcttgggtgtttgagaagagc
cttgtgccattcaaaggagaagaacaatatgagcagctgtgccaggaaagtgcaaagcat
tcccttaccagagcagagaaaataaagatgttaaaacctgtttcaggaaaactgcgtcct
cagtgggaaatgggcatgaagcaagcaaaagatgcattatctttgactgcggaagaacgg
aaagccaagtataccttcttttatattaggggcagacctgttcttaatcctcaggtggcg
aaggaagcaggtcttgctgtcaagtcattggaagaaatggataaaatttacacagatgaa
gacatttctcagtctttgaaatcaaggaaagagtctgatgtccctaccaagagaaggaga
acaaaaatggctgcagctaacgaatctgaggaagacattaaacccgttaatgccagccct
gataaaaccctcgaagagagagaagccaaaagaggcccgggctcacctcttggtaggaaa
aaagctgttacgtacactccgcgaaacaggaagggagatgccgtgtctcagttcttggtt
ttttgccagaagcatagagatgaggtgactgccgaacacgaggatgcttccagtgacgaa
atcgaagagctgctggaatcacagtggaatatgcttagtgaaaaacagaaagcgcgctat
aacacaaaatttgccatagtgacctctcccaaatctgaagaagacaccggttcatcacag
aagagtatgggagaggccaaacgtaaagtgtttcaagaatcacctaaaaggagatcaaga
tccagaagtaacttacatggaaataaaaggcatcccgtaaagaggacaaaggaacccacc
gaagaatttgaagttcaggaagcacctaggaaaaggctcaggatggataaaaagaagaag
gagacgagcaatgacaaaacagcaaaaacaaactctactaaggtcacagaaatctcttcc
tcccaaaagaaccaatcaggtctgtcagatgcatgtaaaccactgaagaagcggaatcga
gcttcagccgcagaatcttcgcatttggcttatagcaaaagttcatctccatcagcttcc
tttactgagaatgagatttcagatggtcaaggggatgagcggccagaatctccctatgaa
agtgcggatgaagtgcaagcagaattgtctctattgtccaaaaaggccgatcgaggatct
gcagcaagaaaggaatacgtttgtcagctctgtgaaaaacctggagatttgctgttgtgc
gaaggacgctgttgtggtgctttccatgcaagttgcactgggctccctgggaagtcctct
gggcgcttcgtttgtggcgaatgctcttcaggtgttcacaagtgttttgtgtgcaaagag
aagaaatcggaagtgaagcgctgcatcgtatcccactgtggaaaattctaccacgaaact
tgtgtgaagaaattccgcctaacagtgttcgacaacagaggctttcgctgccctctccac
agctgtgccagttgccatgttactaacccttcaaatcccaaagtattcaaaggcaaaatg
atgcgctgcattcgctgcccagttgcttatcacgccggagacagctgcatcgctgcggga
tgcgaggtgatcaattcaagcaacattatttgcaccaaccacttcactgccaccaaaggg
aaaagccaccacgcacacgtgaatgtaagctggtgttttgtgtgctcaaaaggtggaagc
cttttatgctgcgagtcgtgtccagcagcatttcacccagattgcttaaacattgaaatg
ccagacgggagctggtattgcaacgactgcaaagcagggaagaaaatccactttcaggat
attatttgggtcaaactaggaaattacaggtggtggcccgcagaagtctgccacccgaaa
aacgtccccccaaatatccagaaaatgaagcacgaggtcggagagtttcctgtgttcttc
tttggctctaaagattattactggacgcatcaggcccgtgtgtttccctatatggaagga
gaccggggaagtcgataccaaggaattaaagggattggaaaagtcttcaagaatgctttg
caagatgccgaggcacgttttcgagaaattaaacttcgtcgggaagccaaagaaactcaa
gaaaacgaacgcaaacctcctccttacaagcacataaaggtaaataaagcttttgggaag
gttcagatttacacggctgacatttccgagattcccaaatgcaactgcaaaccctgtgac
gaaaatccctgtggtctcgattccgaatgtctgaatcggatgctaatgtacgaatgtcac
ccacaagtgtgtccagcgggggaccgctgccagaaccagtgctttaccaagcgccagtac
cccgagacaaagatcatcaagacggacggcaaaggatggggcttgcttgctaagagggat
attaaaaagggtgagtttgtcaacgaatatgtgggtgagctaattgatgaagaggagtgc
atggccaggatcaaatatgctcatgaaaacgacatcacatacttctatatgctcactatc
gataaggatcgcatcatcgacgccggcccgaaaggaaactattcccgatttatgaatcac
agctgccaaccaaactgtgagactttaaagtggacggtgcatggtgacacccgtgtggga
ctgtttgctgtgtgcgatatccctgcagggactgaactgacgtttaattacaacctggac
tgcctgggcaatgagaaaacagcatgtaaatgtggtgctccaaactgtagcggcttcctc
ggggacaggccaaagaattcatcctctaacgcttcggaggagaaaggaaagaaaaccaaa
aggagagcgaggcggcgccgaacaaagagcgaagcgaggaagaaatcggaggactactgc
ttccgctgcaatgacggaggccagctggtgctatgcgacaggaagacctgcaccaaggca
taccacctgtcttgcctgggcttggtgaaacgcccctttgggaaatgggaatgcccctgg
caccactgcgatgtctgtgggaagccttctgcctccttctgccacttctgcccaaactcc
ttctgcaaggatcattacgacgagatgtcactgagttctaacgcaagtggacagttgttc
tgctcggaccacgccggagagaatttcactgccaagaagaccaagagagcccctcggaaa
ctgacccccgtgaagtgtaagaaaaggcaaaggaacaaatggaagaggacggcgtgtaaa
tag

KEGG   Gekko japonicus: 107122041Help
Entry
107122041         CDS       T04299                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  [histone H3]-lysine79 N-trimethyltransferase [EC:2.1.1.360]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107122041 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107122041 (DOT1L)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.360  [histone H3]-lysine79 N-trimethyltransferase
     107122041 (DOT1L)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107122041 (DOT1L)
   HMT complexes
    Dot1-containing complex
     107122041 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 107122041
NCBI-ProteinID: XP_015280553
LinkDB All DBs
Position
Un
AA seq 1561 aa AA seqDB search
MGERLELRLKSPVGAEPAVYPWPLPVYISFFRSSPGDKHHDAAHEIIETIRWVCEEIPDL
KLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHIL
QQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVL
QVAAATNCKHHYGVEKADIPAKYAESMDKEFRKWMKWYGKKHAEYTLERGDFLSEEWRER
IANTSVIFVNNFAFGPEVDHQLKERFANMKEGGQIVSSKPFAPLNFRINSRNLSDIGTIM
RVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKS
NTTTPTKVQENKDDGAEEEKNPGATAVKKPSPSKARKKKLSKKGRKMAGRKRGRPKKMNV
MNPERKAKKNQTALELLHAQTVSQTCSSSPQDAYRSPHSPFYQLPPKVQRHSSNQLLVTP
TPPALQKLLDSFKIQYMQFMAYMKTPQYKENLQQLLEQEKEKNTHLLGKAQQLFSHCQAQ
KEEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLKEQTKQLEKDNGELRNQSLQL
LKARCEELKLDWSTLSLENLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELLQL
KSYMPPDESLPAQPRHKNHLHRESEPDHGAFQLELECPKFPVPQINGMSPELSMNGHATP
YEIQHALGRPSSKQGTPQYAASHLDPDIVPCTPNHNCRQKPDRASSLSLPDYTRFSPAKI
ALRRHLNQDHTGGGKSASNENHQRSEHIKENGVAFPSPTIPNGIKMSPQEPRPSSPAALP
APNEKAFRERTPVSNGETITSLPISIPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSP
VHQNRDSFSTLDKQYGASSHNGVSGAAANKPLTLATSGFSYMTGSGLANGTLSNSPAQLN
HSIDHAALEDGSSSGSLFNSVGSRSSTPQHPSLLAMPSRNSGQNSPAQQHSASPRLNGAC
QSLGGVLQYMDSQKAFAEGTRGDMQVDAAFSDPESEGKRRIIFTISPATGTIKHSPSSKH
SPLTASIRMECGQAYVQDGKKRGRRKRSSTGTPSMNSGVSPKRKSLPMVAGLFTQPSGSP
LNISSMVSNINQPLEITAISSPENSLKNSPVPYQDNDQPPVLKKEKPLIQTNGIHYSPLT
SDEEQGLEDDHNSTRIERKIATISLDSKSPQKPMESSIGLAGRKQASENMNSSKWKSTFS
PISDINLTKTADSPLQAASSLSQNSFFAFRPSAEDTGDGPKAHSRKHAAVSVTGAEGLGQ
SGSSTNGFAYNGGLSADIGLHSFIDGASLPHKPTEVAALGSSSLGFLVQRNRDSGVSEAN
PFLSKRQLESLSTVKGEDIGWPGAKGKEASEPSVRLGGASEKALALHNGKAGKGREAELK
NGHNLFISAAAAVPSGGLLNGKSLSAAAAGNPAGSAAPAQAHHSFLNSLAASSQFPLGSM
ALQANLNSVTNSSVLQSLFNSMPAAAAAGLVHVSSAATRLTNSHAMGSFSPGVTGGTVGG
N
NT seq 4686 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagaggctggagctccggctcaagtcgcccgtcggagccgagccggccgtctac
ccctggcccctgcccgtctacatttccttttttagatcatctcctggtgacaaacaccac
gatgctgctcatgaaatcatcgagacaattcggtgggtctgtgaagaaatcccagacctc
aagcttgctatggaaaactatgttttaattgactacgatactaaaagcttcgaaagcatg
caaaggctttgtgacaaatacaatcgcgccattgatagcattcaccagttgtggaaagga
accacccagcccatgaaactgaacacccgcccctccaacggacttctccgccacatccta
cagcaagtgtataaccactcggtcacagacccagaaaaactcaacaactatgagcccttt
tctccagaagtgtacggagagacttccttcgacttggtggcccagatgatagatgagata
aaaatgactgaagacgatttgtttgtggacttgggcagtggtgtgggtcaagtcgttctg
caagtcgccgcagccacaaactgcaaacatcattatggggtggagaaagccgatatcccc
gccaaatacgcagagagcatggacaaagaattcagaaaatggatgaaatggtatgggaaa
aaacacgcagaatacacactggaaagaggtgatttcctctcggaagaatggcgagagagg
attgctaacacgagcgttatatttgtgaataacttcgcctttggacctgaggtggatcac
cagctgaaggagcgatttgcaaacatgaaggaaggtggccaaattgtatcatcaaaacct
tttgcaccgctgaactttagaataaacagtcgaaacttgagcgatattggcactataatg
agagttgtggaattatcaccactgaaagggtctgtctcatggaccgggaaaccagtttct
tactacctgcatactatcgatcgaaccatacttgaaaactacttctctagtctcaaaaac
ccaaaactcagggaggaacaagaggcagctagacgccggcagcagagagagaacaagagc
aacacgacaactccaacaaaagtccaagaaaacaaggatgatggtgctgaagaagagaag
aatcctggggccactgctgtcaaaaagccatctccgtccaaagcgcgcaagaagaagctg
agcaaaaagggaaggaaaatggcaggccgtaagcgcggacgccccaagaagatgaacgtc
atgaatccagagcgcaaggccaagaagaaccaaaccgcactggagcttctccacgctcaa
actgtgtcacaaacgtgctcatcctctcctcaggatgcctacaggtcacctcatagtcca
ttttaccaactacctcctaaagtgcagcggcattcatcaaaccagctgttggtgactcct
accccacctgcactacagaagctgctagactccttcaagatccagtacatgcaattcatg
gcatacatgaagactcctcagtacaaagagaacctccagcagctgttggaacaggaaaag
gaaaagaatacgcatttgctcgggaaagcccagcagttgttttctcattgccaagctcag
aaagaagaaataaagcggctgttccagcagaagctagatgagctgggagttaaggccttg
acctacaacgaccttattcaagctcagaaagagatctctgctcacaaccaacagcttaag
gagcagaccaagcagctggagaaagataacggcgaactcaggaaccagagtctgcagctg
ctgaaggccaggtgtgaagaactgaagctggattggtcgaccctgtcactggagaatctg
ctgaaagagaagcaggcactgaagaaccagatttctgagaagcaaaagcattgcttggaa
ctgcagatcagcatcgtggaactcgagaagagccaaaggcagcaagagctcctgcagctg
aagtcgtacatgcctcccgacgaatcgctgccagcgcagccgcgccacaagaaccacctg
caccgcgagtcggagcctgatcacggagcgttccagctcgaactggagtgccccaagttc
ccggtgccccagatcaacggcatgagccccgaactgtccatgaacggccatgccaccccc
tatgagatccagcacgccctcggcaggccctcctccaaacagggcaccccgcagtacgca
gcctcgcacctggacccagatatagtcccttgcaccccgaaccacaactgcaggcagaag
ccggacagggcctcgagcttgtccttgccggactacaccaggttctccccagctaaaata
gccctgcggaggcacctgaaccaggaccatacgggcggtgggaaatcagccagtaatgaa
aaccatcagagatccgagcacataaaagagaatggtgtcgcgtttccgagcccgacgata
ccaaacggcataaagatgagccctcaggaaccccgtccctcttcaccggcagctttgcca
gctcctaacgagaaggctttccgggagaggacacctgtgagcaacggggagaccatcacc
agcctccccatcagtattcccctcagcacggtgcagcccaataagctccctgttagtatt
cccttggccagcgttgtcctccctagccgtgttgagaaggtgagaagcacaccgagcccc
gtccaccagaaccgtgactccttttcaacacttgacaaacaatatggtgctagttctcat
aacggcgtgagcggtgctgctgccaacaagccactgactttggctacctcaggtttttct
tacatgacaggctctgggttggccaatgggaccctttcgaacagccctgcccagcttaac
cacagcatcgaccacgcagctctggaggacgggtccagttcaggaagcttgtttaattca
gtgggatctcggagctccactccgcagcacccttctctgctggcgatgccctcgcggaat
tccgggcagaactcccctgctcagcagcactccgcaagccccaggctgaacggggcctgc
cagagcctgggaggggtattgcagtacatggactcccagaaagccttcgctgaagggaca
cggggggacatgcaggtggacgcagcgttctccgatcccgaaagcgagggcaagcgaagg
atcatcttcaccatctctcctgccacgggaaccataaagcactctccttccagtaagcac
agcccgcttacggcaagcatccggatggagtgtggccaggcctacgtgcaggacgggaag
aagcgcggccggaggaagcggtcctccacggggacgcctagcatgaactctggggtgtcg
ccaaaacgcaagtcgttgccgatggtggctgggctcttcactcagccgtcggggtctccg
cttaatatcagttcaatggtnagtaacattaatcagcccttagaaatcacagccatttca
tcccctgaaaattccctgaagaactctcctgtcccgtaccaggacaacgatcagcccccg
gtgctgaagaaggagaagcccctcattcagaccaacgggatccactactcgccactgact
tctgacgaggagcagggcttggaggacgaccacaacagcacccgaattgaaagaaaaatc
gcaacgatatcactggacagcaaatctccacaaaagccaatggagagcagcatcggctta
gctgggagaaagcaagccagcgaaaacatgaacagcagcaaatggaagtccaccttctct
ccaatctcggacatcaacctgaccaaaacggcagatagccccctgcaggcggcatcgtcc
ctgagccagaactccttcttcgccttcaggccctccgcggaggacacgggcgacggtccc
aaggcccactcgaggaagcacgccgccgtgtccgtcaccggggccgagggcctcggccag
agcggcagttccacgaacgggtttgcttacaacggcgggctgtcggcagacattggttta
catagctttatcgacggtgcttcgctcccgcataaacccaccgaggtggcggcactgggg
agctcctcgctggggttcctggtgcagcggaacagagactccggggtctcggaggcaaac
cccttcttgagtaaaaggcagctagaaagcctgagcaccgtgaaaggggaagacatcggc
tggccgggggccaaaggcaaagaggccagcgaaccgagtgtccggctggggggtgcttcg
gaaaaggccttggcgctccacaacggcaaagctggcaaagggcgggaggcggagctcaag
aacggccacaatctcttcatctccgccgcggccgccgtgccttccgggggccttctcaac
ggcaaaagcctttccgcggccgccgccggtaacccggccggttcggccgcccccgctcag
gcgcaccactccttcttgaactccttggccgccagctcgcagttccccctcggctccatg
gccttgcaagcgaacctcaactctgtgacaaactcctcggtcctgcagtccttatttaac
tcgatgccggccgccgctgccgccggcctggtccacgtgtcatcggcggcgacgcgcctg
accaactcgcatgccatggggagcttctctcccggggttacaggtggaacagttggaggt
aactag

KEGG   Gekko japonicus: 107123156Help
Entry
107123156         CDS       T04299                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2C-like
  KO
K09188  [histone H3]-lysine4 N-trimethyltransferase MLL3 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107123156
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107123156
   03036 Chromosome and associated proteins [BR:gja03036]
    107123156
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107123156
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107123156
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107123156
   HMT complexes
    MLL3/MLL4 complex
     107123156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 107123156
NCBI-ProteinID: XP_015281829
LinkDB All DBs
Position
Un
AA seq 758 aa AA seqDB search
MVVTSSSKSKGTHSAPSDKESRKLDAFGRRLYSTGALGVKTTNYLACMSRYQYTLWERLA
ELLAHLPEDKHQAARIIQKEGMVLVKQQINTSKHDLDTSSRTMASAIALRSHSLLRNTNL
QPDTRSYVEDLSFDGLGLFNSTTDTILQDMDKSIKASRALGVSSSTRQQYRPRPWSRPWH
KCTPNRQSLDWQWRPRTSSGGQKPSFQKPRFGSGQQSSRSKEAKSAKPRSRGKPAVEDED
SMDGLEAAETENTVETEVKEQSSEEDAHTEVDGNKKLTPILQRAVSEESASSVASIGVEA
KTREHLCAFCYCGERSSLGQGELKQFSPTPGFITPWNNQALKKSETGEGNDSISESTPRQ
NSVPLKSRGQKKEKSHQSITSCTSISTQTTPDDQVVRIWDELKMVGLPDDIDVQALFEPT
GHCWAHHRCAEWSLGACQTEESLPVNVDKAVVSGSTKQCAYCKHLGATIKCCEEKCTQIY
HYPCAAGAGTFQDFSHFSLLCPDHIDQAPQRSKEEANCALCDSPGDLLDQLFCTTCGQHY
HGMCLDIQVTPIKRAGWQCPDCKVCQNCKHSGEDNKMLVCDTCDKGYHTFCLQPVMDSVP
TNGWKCKNCRICAECGTRTSSQWHHNCLMCDSCYHQHDSLPCPFCEKSSHPDLQKDKLRC
HMCKRWIHIECDKPPDNDLDAQLKEYICSLCKHSEGEEVHSQPCDIMETAQLLPETGTDE
MEIEDGADDMVKKDQLIMDSSLAQESAIGCIVDGKNIV
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcacttcctcatccaagtccaagggaacacattctgcaccttcagacaaggag
agcagaaagttagatgcatttggacgacgtttgtactctacgggagcactaggagtaaag
accaccaattacttagcgtgtatgagtagataccagtacactttgtgggaaaggcttgct
gagcttctggctcaccttccagaagacaagcatcaggcagcccgcatcatccaaaaggag
ggcatggtgctggtaaagcaacaaatcaatacctccaaacatgacctagacacttcctca
aggacaatggcttcagccatagctctacgaagccattccttgctacgcaacaccaatcta
cagccagatactaggtcatacgtagaggacctctcctttgatggccttggtctgtttaac
agtactacagacaccatattacaagatatggataaaagcataaaagcttctcgtgctctg
ggcgtttcctcatccacgaggcagcaataccgacctcgtccctggtccagaccctggcac
aaatgcaccccaaaccgtcaatctcttgactggcaatggaggccacgaacatcctctgga
ggccagaaaccctcattccagaaacctagatttggatcgggacaacagtcttcccgcagt
aaggaggcaaagtccgccaagcctcgaagtagaggaaaacctgccgtggaggatgaagac
agtatggatgggttggaggcagcagaaacagaaaacactgtggaaaccgaagttaaagaa
caatcttcagaggaggacgcgcacactgaagtggatggcaacaagaagctaacaccaatt
cttcagcgcgcggtgtctgaggaatctgcaagctccgttgcctcaattggcgttgaagcc
aaaaccagagaacatctctgcgccttttgttactgtggggaacgaagctcattaggacaa
ggagaactgaaacaattcagtccaacaccagggtttatcactccatggaacaaccaggct
ttaaagaagagtgaaactggggaaggcaacgatagcatttctgagagtactccaaggcag
aactcagtcccactcaaatcaagaggacaaaagaaagagaagtctcatcagagtataaca
tcatgtacaagtataagcactcaaactactcctgatgatcaagtagtcagaatctgggat
gaactcaaaatggttggcctaccagatgacattgatgtccaagccttatttgagccaaca
ggtcactgctgggctcatcaccgctgtgcggagtggtcactgggagcatgccagactgaa
gagtcgctaccagtgaatgtggacaaagccgttgtctcagggagcacaaaacaatgtgca
tattgtaagcaccttggagccactatcaaatgctgtgaagagaaatgcacccagatctac
cattacccatgtgctgctggagcaggcacttttcaggattttagtcacttctcccttctt
tgcccagaccacattgatcaggctccacaaagatcaaaggaagaagcaaactgtgcattg
tgtgatagccctggagacctcctagatcaacttttttgtactacctgtgggcagcattac
catgggatgtgtctggatatccaagtgacacctataaaacgggcaggttggcagtgtcct
gactgcaaagtgtgccagaactgcaagcattccggagaagataacaagatgcttgtgtgt
gatacatgcgacaaagggtatcacaccttttgtttacaaccagttatggactctgtacca
acaaatggctggaaatgcaaaaactgcaggatatgcgcagaatgtggcacacgtactagt
agtcagtggcatcacaactgtcttatgtgtgacagttgttaccatcagcatgacagccta
ccttgtcctttctgtgaaaaatcatcccatccagacttgcaaaaagacaagctgcgttgc
catatgtgcaaaaggtggattcacatagaatgtgacaaacctcctgataatgacctggat
gctcagttaaaagagtatatctgcagtctctgcaaacattcagaaggggaagaagtacat
tcacaaccatgtgatataatggagactgcccaactgcttcctgaaactggcacagatgaa
atggaaatagaagatggtgcagatgatatggtaaagaaggaccagctaataatggacagc
agccttgctcaagagtcggccattggatgcatcgtagatggtaagaacattgtgtag

KEGG   Gekko japonicus: 107123162Help
Entry
107123162         CDS       T04299                                 

Gene name
KMT2C
Definition
(RefSeq) lysine methyltransferase 2C
  KO
K09188  [histone H3]-lysine4 N-trimethyltransferase MLL3 [EC:2.1.1.354]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107123162 (KMT2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107123162 (KMT2C)
   03036 Chromosome and associated proteins [BR:gja03036]
    107123162 (KMT2C)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107123162 (KMT2C)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107123162 (KMT2C)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107123162 (KMT2C)
   HMT complexes
    MLL3/MLL4 complex
     107123162 (KMT2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC FYRN SET PHD zf-HC5HC2H_2 zf-HC5HC2H HMG_box
Motif
Other DBs
NCBI-GeneID: 107123162
NCBI-ProteinID: XP_015281836
LinkDB All DBs
Position
Un
AA seq 4392 aa AA seqDB search
MEPSSKKSPVLDDDCIDKQMEVAENIPDIMQQVSDKQAEEMKPSQDETEVLKVSTEECQL
PPVTPDTIAKMPETFVLVNKERPSFRKEEQLEARIVPQNAEGGNTPENYETSSLPASESC
ATDSSPSGEKSLKSPAETYSSFPSSVEINKTSVSSSPAASLELGSSHDMMRSQASSLESS
ATLPGTYVSFTPKIGMGKPAITKRKFSPGRPRSRQGAWSTHNTVSPPSWSPDISEGRETF
KSRLLSGSAMWSIKVGRGSGFPGKRRPRGAGLSGRGGRGRSKLKNGIGCLLTPGVMDMDT
LSSKDEEENSMHNTVVLFSSSDKFTLQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCV
SIKITKVVLHKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGW
KCKWCVWCRHCGATSPGLRCEWQNNYTQCAPCASLSTCPVCCCSYREEELILQCRQCDRW
MHAVCQNLNTEEEVENTADSGFDCSMCRPYIPPANVPSSECCESSVAAQIVAKAKELDPP
KTYTQDGVCLTEVGLSQLQSLSAVVPRRKRTKPKLKLKIINQNSVAVLQTPPDIQSEHSR
DGEMDDSREGDLMDCEGKSDTSPEREPAEDDPKGVEGTDGIKKRKRKPYRPGIGGFMVRQ
RSRTGQGKTKRSLSRKDSSGSVSEQLPNREESWSEQLPDTPVDESIPASENTEKIKKRYR
KKKNKLEETFPVYLQEAFFGKDLLDTSRQSKPSLDNLSEESLNISCKVNLNTSFLDPSSD
LLLSATSTPAPSKLGIQGTSDDPLAALSDVLNTEEDILGILSDDLVKSGEHSGLDLCTFQ
VENSSSPFAGLDIGPISEDPSSLPPQCVSQTSRPLSEEQLDGILSPELDKMVTDGAILGK
LYKIPELEGKDVEELFTAVLSPATTQSAPLPQAPPPPQLVHLHNQGENVFSRVPLINGLI
GPAPHLSHTPLVPGGGLGTFPTIAQPSYTDTRDKNATFNAVMNDTTSSWVPSAAPLEGEG
DTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWSTRVKQIAKLWRKAS
SQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSELFKDPLKQRESE
HEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQLQQQLGSQQLLNPSGSDTPSSGMQ
SPLTPQTGNGSMSPAQQTFHKDLFTKQLPGTPTSTPSDVFLKPQPPPPPATPNRMPVQDA
HSQAPSQPIFPPSSSNTRPPSPVDPYAKMVGTPRPPPVNQNQNFVRRNSVTSADVRPPPS
PISRPAQVSESTGSRPSPVRDLSLSPVSSDPYSKPPDTPRPIAATEPFSKPLGLPRSPLI
AEQPGKPLTAANNDPFMKPSPRTDAFQRPRMSPADSYVRLPLTPTSVVEGSPGTFKTPMR
PPQSPQDPYASMPSTPRRMSVDPYERPVLTPRPVDSFSHNSSNDLYSQPPLTPHTAIKDT
FAHPQRVVRNQSDSFSQSGTILRGGAQDPYSQPPGTPRPVSDPYAHPPGTPRPVSIPYAQ
PPGTPHPVSDPYTQPPGTPRPVSDPYAQPPGTPRPVSDPYTQPPGTPRPSTVDPYMHQPP
TPRPAQAADLFAQVPANQRHSDPYVKPPGTPRPVSNDPYSQPPATPRPGISETYSRPAAM
PNRDSYLQNRTLPGTFVRPSDPCTQPPRTLGSAAADSFSHVPTAPSCDPYDQPPVTPRPQ
PETFGTAQLPHDAVDQPRSGSEGNFSASANSSMSSQGQQFPQTSQVSGPAPTTGATNTQS
TMSQVDEEKLRQRQKLREIILQQQQQKKNAARQEKTPQLPVTAPHAAPVQQWQQENLSQV
FSRPPPPYPGNVRSSVVPPGGLRFPGFAVDGQFNRSQFPGDLGGMGVRPHGIRFGFSGGG
RGPPQCQERFLGPPQQMQRSGVPPQLRRSMSISMPRLPNKPQMGNPIGLSQHFPPQGIQV
QQHNIMGQAFIELCHRAPEGRPRLPFNSSSATVISTVPQHQQRTGFLPQQDCQGSRQLEP
ARHNPQSLNNPLHVSTSLEHLPPSQQGPVNPNPVLVMCPLNNPPVNEAFSGTPLPASTSA
ETPRGLQIPTQHAGGLEEKLDPDDPAVKDLDVKDLDGVEVKDLVDEDLENLNLDPEDGKG
DELDTLDNLETNDRHLDDILRSGEFDIIAYTDPELDLGDKKGMFNEELDLSVPIDDIQGK
ADDAQQKPQDNKAAVPSDLLAPQKKPVEVTEIKTEALSPSTLEETQPENEKSDGNAASSS
TPLTTETELVDGEEKSMVLCNVELPDKANTNEEITVSNPGAVQGSAPPPAQSITSPCNIS
GSTPVLTSLLANESSENSDVRPLNSPPHSLPAAQANPVSSIPQTLMTPAGQTMENALPPN
VNMVPQISHNFPQGTAVNPGFITGQPVAHNLETGHPGNQTVPVVNRPGPSGMLPSQQMML
PQALGQQQNRERPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAI
TDPIMKAKMVALKGINKVMAQNNMGMPPMVMNRFAFMGQSVPGTPSGEGQNLVQQAITQD
GNLTPQISRPNPPNFGPGFVNDSHRKQYEEWLQETQQLLQMQQKFLEDQIGAHRKSKKAL
SAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKELEQIRKQQKEHAELIEEYRIKQQQC
GIGPHAMMPGMPSQPPMVPGGSPPAMGQQSFPMVPQQLQHQQHTAGVPGQPNQPRMPSLP
GWQPPNTAPTHISHNAPRLQPPLAQLPLNPVTPTSVSAPGASVQSGPPPRVEFDDNNPFS
ESFQERERKERLREQQERQRIQLMQEVDRQRALQQRMEMEQHGTVGSELNARPSLSQVPF
FNSDLPCDFIQPPRPLQQSPQQQQQMGPILQQGPLNSASAPNFLLCSEQQPVGSSPFGPD
RPPVPDGSPTFHSVKQSHGSVSGAGFSQYPVRPQFAPGLPAASPVAVPGSPCSQDSGMTH
GTNCPGVSQSLIQLYSDIIPEEKGKKKRTRKKKKEDDAESVNTPSTPHSDITAPPTPIVS
DSVSTPTVSTPGELSHHPGEAEAEELPGSSTLNAAESQSSLELKGQLSDSDLPQNKLPEQ
SSVKPETDKVKTDASGSIQEIRQEKTEADQCPSQAEPKLENQSGIKVEEDKASALPAPFS
EGQAQPTSIPAAKGESGNELLKHLLKNKKSASLLNQKSKSGFPSEESTEESKFVAKQDPA
ESSMQSLGNPLQGPPGCGNSQLQRADVGHEMKKQRNKRTQRAGEKTAPRSKKRKKEEEEK
QAIYPNADTFMQLKQQLSLLPLMEPIIGVSFAHFLPYGSGHLNSGSRLMGSFGSATLDGV
SDYYSQLIYKQNNLSNPPTPPASLPPTPPPVACQKMVNGFATTEELASKAGMLGGHDVTK
ALGPKQFQLPFRPQDDLLARAMAQGPKSVDVPASLPTPPHNNHEELRVQDPCGDRDTPDS
FVPSSSPESVMGMEISRYPDLSAVKEEIPEPVPSPIIPILPTSTGKGSEAKRNFIKTEPG
SGFFGFQLGPSPNGPKSGLVSVAITLHPTAAENIGNIVAAFSSLLHVRIPNSYEVSSAPD
VPSSVGMMNTPRANPAFEYRQQLLLHGPQPGTVGSLGFMGPYGLKQPNMPFPPSGNGLAG
YKAHSSSMTDSSVLRPQWCSHCKVVVLGSGVRKSFKEPPFLKQDSRERSERMEKDVVFCS
NNCFVLYSASMQAKNSESKESIPSLPQFHMKEAPPKGFHQYNNNISTLDVHCLPQFQEKV
SPPSSPLITFPPAFEAARVEPKPDELKVTVKLKPRLRTIPNGLDDCRPLNKKWKGMKWKK
WNIQIVIPKGTFRPPCDEEIDEFLRKLGTTIKPDPVPKDYRKCCFCHEEGDGLTDGPARL
LNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCTFCHKMGATSGCHRLRC
TNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGAHEQELSYFAVFRRVYVQRDEVRQIASIV
QRGDREHTFRVGSLIFHTIGQLLPHQMQAFHSSRVLYPVGYEASRLYWSTRYANRRCRYL
CSIEEKDGLPLFVIRITEQGHEDVVLTDSYPKGVWDKVLDPVVAVRKSSEMLQLFPAYLK
GEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAINPTGCARSEPKMSTHV
KRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSR
IQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNDHVIDATL
TGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQHKIPC
HCGAVNCRKWMN
NT seq 13179 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatcctctaaaaagagtcccgtgcttgatgatgattgcattgacaaacagatg
gaagtggctgagaatattccagatataatgcagcaagtatcagacaagcaagcagaggaa
atgaagccatcacaggatgaaactgaggtgttaaaagtgtccacggaggaatgtcagctt
ccacctgtgacacctgacaccatagctaagatgccggaaaccttcgttttggtaaacaaa
gagagaccctccttcagaaaagaagagcaactagaagcaaggatagtgccacaaaatgca
gaaggaggtaacactcctgaaaattatgaaacatcatctcttcctgcaagtgaaagttgt
gcaactgacagttcaccatcaggagagaaatctttaaaatcaccagctgagacatattct
tcatttccatcatctgttgaaataaacaagacaagtgtgtcttcctcaccagcagcttca
ttagagttaggctcttcacatgacatgatgcgcagtcaagcttcatcgctagaatcctca
gcaactcttccaggaacatatgtatctttcactccaaaaattggcatgggaaaaccagct
atcaccaaaaggaagttttctcctgggaggccaaggtcaagacagggggcttggagtacc
cataatacggtgagcccaccttcctggtccccagacatttcagaaggtcgggaaactttt
aaatccagactgctatctggcagtgccatgtggagcatcaaagtgggtcgtggatcaggg
ttccctggaaagcggagaccacgtggtgcaggcctttctggaagaggtggaagaggaagg
tcaaaactgaagaacggcattgggtgtcttcttactccaggggtcatggatatggatact
ttgtctagcaaagacgaggaagaaaattcaatgcacaatactgttgtactattttccagc
agtgacaagtttactttgcagcaggatatgtgtgtcgtttgtgggagctttggccaaggt
gcggaaggccgattgcttgcctgctcccagtgtggtcagtgttatcatccctactgtgtc
agtattaagattacaaaagtggtgctccacaaaggttggaggtgcctggagtgcaccgta
tgtgaagcctgcgggaaggcgactgacccaggacggctgcttctttgtgatgattgtgat
atcagttatcacacgtactgcctagatccaccactgcagacagttcccaaaggagggtgg
aaatgcaaatggtgtgtttggtgcagacactgcggagcgacttctcctggcctaagatgt
gaatggcagaataattacacacagtgtgctccttgtgcaagtttatctacctgtccagtc
tgctgctgcagttacagagaagaagagcttattctgcagtgcaggcagtgtgacagatgg
atgcatgcagtctgtcaaaacttaaacacagaagaggaagtagaaaacacagctgacagt
ggttttgactgttccatgtgtaggccgtatattccaccagcaaatgtgccttcctctgaa
tgctgtgaatcgtcagttgcagcccaaattgtagcaaaggcaaaggaacttgacccaccg
aagacatacacccaggatggagtctgtttgacagaagtaggactgtctcagttacaaagc
ctcagtgctgttgtaccaagaagaaaacggacaaagccaaagctcaagttgaaaattata
aaccagaatagtgtggccgtactccagactccacctgatatacaatcagaacattcacgg
gatggcgagatggatgacagtagagaaggagaccttatggactgtgaaggaaaatcagat
actagccctgaacgggagcctgcagaagatgatcctaagggggtagaaggaacagatggg
atcaagaagagaaaaagaaaaccatacagaccaggcattggtggattcatggtgcgtcag
agaagtcgtacggggcaaggaaaaacaaagcgatctctctccaggaaagattcctctggc
tccgtatctgagcagttgcctaacagagaggaaagctggagcgaacagttgccagataca
ccagtggatgaatctattcctgcttctgaaaatacagagaagattaaaaaacgttacagg
aaaaagaaaaacaagcttgaagaaacctttccagtgtacttgcaggaagcattctttggg
aaagatctcctagacaccagtaggcaaagtaaaccaagtttagataatttatctgaagaa
agccttaacatttcatgcaaagtaaatttgaatacaagcttcttagatccatcttcagac
ctactactcagcgcaacttctactccagctccatcaaaacttggaatacaaggtacctct
gatgatcctttagcagccctttcagatgtgttgaacactgaagaggatattcttggaata
ctctctgatgatttggtgaaatctggggaacattcaggtcttgatttatgcactttccag
gttgagaactcatcttccccatttgctggactagatattggacccatctctgaagatccc
tcctctttgcctccacaatgtgtcagtcagacttcaagaccgttgagtgaagaacaacta
gatggaatcctcagccctgaactggacaagatggtcacagatggtgcaattcttggtaaa
ctgtacaagataccagagctggaaggaaaggatgttgaagaactgttcactgctgtactg
agtcctgcaaccacccaatcagctcctttgccacaggccccacctccaccacagctggta
catttgcacaatcaaggagagaatgtgttttcaagagttccgcttattaatggtttgatt
ggaccagcccctcatctctctcataccccattggttcctggaggcggattaggcactttt
cctaccatagcacaaccatcatatacagataccagggataagaacgcaacgtttaatgca
gtgatgaatgataccaccagttcttgggtcccatctgctgccccactggaaggtgagggt
gacaccatgtctaatgcacagaggagcactctgaaatgggagaaagaggaagcacttggt
gaaatggcaacagtggcacctgttttatatacaaatatcaattttccgaaccttaaagaa
gagttcccagactggtcaactagagtgaagcagattgctaaactgtggagaaaagcaagc
tcacaggaaagagcgccatatgtgcaaaaggccagagataatcgagctgctctgcgaatc
aacaaagtgcagatgtcaaatgattccatgaaaaggcagcagcaacaggatagcattgat
ccaagctctcgtatcgactctgaactctttaaggacccattaaagcagagggaatcagag
catgagcaagagtggaagtttagacagcaaatgcgtcagaaaagtaaacagcaagctaaa
attgaagccactcagaaacttgagcaagtaaaaaatgagcagcagcaactgcaacagcag
cttgggtcgcaacagctcttgaacccgtcaggttcagacacaccaagcagtgggatgcag
agtcccttaacccctcagactggcaatggaagtatgtctcctgcacaacagacattccac
aaagacttatttacaaaacagttgcctggtacccctacttccaccccttctgacgtattc
ctaaaaccacagccccctcctccgcctgcgacaccaaatagaatgcctgttcaagacgca
cattctcaggctccttcacaaccgattttcccccctagctcctctaacactagaccgcct
tctccagtcgacccatatgcaaaaatggtgggaacgcccaggccaccacctgttaaccaa
aatcaaaactttgtcaggagaaattctgttacatcagcagatgtccgtccacccccatca
cccatatccaggccagctcaggtatctgaatcaacaggaagccggccatcaccagtcaga
gatttgtctttgtctcccgtcagcagtgacccttattcaaaacctccagatacacccagg
cctatagcggcaacagaaccattctcaaaacctttggggctaccaagatcacctttaatt
gcagaacaaccagggaaacctttaacagcagcaaacaacgatccgttcatgaagccatct
cctagaacagatgcatttcaaaggcctcgaatgtctcctgccgattcgtatgtacggcta
ccgttgaccccaacttctgttgtcgagggaagtcctggtacatttaaaacgccaatgcgc
cctcctcaatccccacaagatccttatgcctcgatgccctccaccccaagacgtatgagt
gtggatccctatgaacggcctgtattgacaccaaggcctgtggatagcttttcgcataat
tcatctaatgacttatacagtcagccccctctgactccccacacagcaataaaagacacc
tttgcccatcctcaaagagtagtgcgaaaccagagtgattctttttctcagtctggaact
attttaaggggaggtgctcaggacccttattcccagcctccaggtactccacgcccagta
tcagatccttacgcccatcctccgggtactccgcgcccagtctcgatcccttatgcccag
cctccgggaactccgcatccagtgtcggacccttacacccagcctccaggtactccacgc
ccagtgtcggacccttacgcccagcctccgggtactccgcgcccagtctcggacccttac
acccagcctccgggtactccgcgaccctctactgttgatccatatatgcatcaaccaccc
accccaagacctgcacaggcagcagacttatttgctcaggttccagctaatcaaaggcat
tctgacccatatgtcaagcctccaggtacaccaagaccagttagtaatgatccgtattct
cagccaccagcaaccccaaggcctggaatatcagaaacttacagtagaccagctgcgatg
cccaatcgagattcttatctacagaataggactttacctgggactttcgtaaggccatct
gatccatgtactcagcctccaagaacattgggatctgctgcagcagattcttttagccat
gttccaacagccccatcgtgtgacccttatgatcagcctccagtgactccaagacctcag
ccagaaacctttggaactgctcagcttccccatgatgctgtagatcaaccaagatctgga
tctgaggggaacttcagtgcatctgcaaactcttccatgagctcacaggggcaacagttt
ccccagacctctcaagtttctggcccagcaccaacaacaggagcaacaaatacacagagc
acaatgtctcaggtagatgaagagaaattaagacagcgccagaaattacgtgaaattatt
ctgcagcagcagcaacaaaagaagaatgcagcacgtcaagagaaaacaccgcagctgcct
gtcacagcacctcatgcagctcctgttcagcaatggcagcaggagaatctgagccaggtt
ttcagtcggcctcctccaccctaccctggcaatgttaggtcatctgtggtcccacctggt
ggcttaaggttcccggggtttgctgttgatggacaattcaatagatcccagtttccagga
gatctgggtggcatgggagtgaggcctcatggaattagatttggtttttctggaggtggt
cgtggtcctccacaatgtcaagaacgtttccttggtcctccacaacagatgcaacgttct
ggagtcccaccacaactaagaagatccatgtctatcagtatgcctagactacccaacaaa
ccacagatgggtaaccctattggattgtctcagcatttcccaccacaaggtattcaggtt
caacagcacaatataatgggtcaggcatttattgagctgtgtcacagagcgcctgaaggc
agaccaaggcttccttttaattcctcctcagctactgttataagcacagttccccaacac
caacaacgtacagggtttttacctcagcaggactgccaaggctcaagacaattggagcca
gcaaggcataaccctcaaagcttaaacaacccgttgcatgtgtcaacaagcttggaacat
ttaccgccatctcagcaaggtccagtgaatcccaatcctgtgctagtaatgtgccctttg
aataatccaccagttaatgaggctttttcaggaactcctttgccagcatcgacatcagct
gagacaccaaggggtttacagattccaacccagcacgctggtggattagaggaaaagctt
gatcctgatgatcctgctgtgaaagatttagatgtcaaagaccttgatggtgtggaggtt
aaggatttagttgatgaagatcttgaaaatctcaatctagacccagaggatgggaaagga
gatgagctggacacattagataatctcgaaacgaatgatcgccaccttgatgacatcctg
aggtcaggagaatttgacataattgcttacacagatccagaacttgatttgggtgacaaa
aagggtatgtttaatgaggaactggatctcagtgtccctatagatgatatccagggcaaa
gcagacgatgcccagcagaagcctcaagataataaagctgcagttccctcagacttgctt
gctcctcagaaaaaacctgttgaagtcacggagattaaaacagaagcgctctctccaagt
acattagaggaaactcaacctgaaaatgaaaaaagtgatgggaatgcggcatcctcaagc
actccacttaccactgaaacagaattagtagatggagaggaaaagtccatggtcctttgt
aatgtggagctaccagacaaagcaaatactaacgaggaaatcactgtgtctaatccaggt
gctgttcagggctctgctccaccacctgctcaaagtataacaagcccttgcaatatttct
ggatcaactccagttcttacaagtttgctagctaacgagagttcagaaaactctgatgtc
aggccactgaactccccacctcactctttgccagcagcacaagccaaccccgtttcaagt
attccacagactttaatgacacctgctggtcagaccatggaaaacgcattacctccgaat
gtgaacatggttccacagataagccataattttcctcaagggacagcagtgaatccaggc
ttcatcactggccagccggttgcccataacttggagacagggcatccaggtaatcaaact
gtgcctgttgtgaatcgtcccggtcccagtggaatgcttccttcccagcagatgatgctc
cctcaggcattaggccagcagcaaaaccgagagaggcctcttctgctagaggaacagcct
cttctgctgcaggatcttttggatcaagaaaggcaagagcagcagcagcagcggcagatg
caggccatgattcgccagcgttcagagccatttttccccaacattgattttgatgcaatc
actgatcctataatgaaagcgaaaatggtggctcttaaagggattaataaggtcatggca
cagaacaatatgggaatgcctccaatggtcatgaacagatttgcctttatgggtcaatcg
gttccaggaacaccgagtggggaaggccagaatctagtacagcaagcaattacacaggat
ggaaacctaacacctcagatttctagaccaaaccctccaaattttggtcctggttttgta
aacgattcacatagaaagcaatatgaagaatggctgcaagagacacagcagctacttcaa
atgcagcagaaattccttgaagaccaaatcggagcacacagaaaatcaaaaaaagcgctc
tctgcgaaacagcgtactgcgaaaaaagcaggccgagaattcccggaagaagatgcagag
cagcttaagcatgttacggagcagcagagtatggttcaaaaggagctggaacagatacga
aagcaacaaaaggagcatgcagaactcatcgaagagtaccgaataaagcagcaacagtgt
ggcataggccctcatgccatgatgcccggcatgccttctcagcccccaatggtcccagga
ggatcaccaccagcaatgggtcagcaaagcttcccgatggtaccacaacagcttcagcat
cagcagcatacagctggtgttcctgggcaacccaaccaacctcggatgccaagtttgcct
gggtggcagcctcccaacactgccccaacacacatctcccacaatgcaccaaggctgcag
cctccactagcacagttgccgttgaatcccgtgacacccacttctgtgtcagctcctggt
gcaagcgtgcagtcagggccaccgccacgtgtcgagttcgatgacaataacccgttcagc
gaaagcttccaggagcgggaacgaaaggaacgtttgagagaacagcaagaaaggcaacgg
attcagcttatgcaggaggtggatcggcagagagctttgcagcagagaatggaaatggag
caacatggcacagtgggctcagaattaaatgctaggccttccttgtcccaagtaccattc
ttcaattctgacctgccatgtgatttcatacagcctccacggccccttcagcagtctcca
cagcaacagcaacaaatgggacccattttgcagcaaggaccgttgaacagtgcatctgcg
cccaactttctactgtgtagtgagcaacaacctgtgggatcttccccttttggacctgat
cgaccccctgttccagatggaagtcccactttccattctgttaaacaatcccatggaagt
gtctctggggccggttttagtcagtacccagttaggcctcagtttgcccctggcttgcct
gcagcttctcctgtagctgtccctggttccccctgtagtcaggacagcggcatgacccac
ggaaccaactgccctggagtaagtcagtctctcattcagctgtattctgatatcattccg
gaggagaaaggcaaaaagaaaagaacaagaaaaaagaaaaaagaggatgatgctgaatca
gtaaataccccgtcaacaccacactcagatataacagcacccccaacaccaattgtttca
gattctgtctccaccccaacagttagcacgcctggtgaactttcacaccatccaggggag
gcggaggcggaagaactgccaggctcatcaactctgaatgctgcggagagtcagtcttcc
ttagaactgaaaggtcagctctccgatagtgatttgccacaaaacaaattgcctgagcaa
tcaagcgtaaagccagagacagacaaggtcaagacagatgcttctgggagcattcaggaa
attagacaggaaaagacagaagctgatcaatgccctagtcaagctgagcctaagttggag
aatcaaagtggcattaaagtggaagaggataaagcttctgcgctgcctgcccctttctca
gagggtcaggcacaacctaccagcatccctgcagcaaaaggggaatcggggaacgaactc
ctcaaacacttgcttaagaacaaaaaatctgcctctcttctcaatcagaaatcaaaaagc
ggcttcccgtcagaagagagcactgaggagagcaaatttgtggcaaaacaggacccagcc
gaaagcagcatgcaatcactaggaaatccattgcagggcccacctggatgcggtaacagc
cagcttcaaagagcagatgtagggcatgaaatgaaaaagcagcgaaacaaacgaactcag
agggcaggtgagaagacagcgcctcgatctaagaagaggaaaaaagaggaagaagaaaaa
caggctatttaccctaatgctgacacatttatgcagttaaaacagcaactctctttgctg
cctctgatggagccaataattggcgtgagttttgcccacttcctgccgtatggcagtggc
cacctgaatagtggaagtcgccttatgggaagctttggtagcgctacgcttgatggggta
tcagattactattctcagctaatttacaagcagaacaacctgagcaatcctcccacccct
ccagcctcactcccgcccacacctccacctgtggcttgccaaaaaatggtcaatggattt
gcaaccactgaggaacttgctagcaaggctgggatgctagggggacatgacgttaccaag
gctctaggacccaagcagtttcagctgcccttcagacctcaggatgatttgttagccaga
gccatggctcaaggtcctaaaagtgtggacgttcctgcttcccttccaaccccgcctcat
aataatcatgaagaactaagggttcaagatccttgtggtgacagagacacgcctgacagt
tttgttccatcttcatcgcctgagagtgtcatgggtatggaaataagtaggtatcctgac
ctgtcagctgtcaaggaagagatcccagaacctgttccatctcctatcattccaatccta
cccaccagtactggaaagggatcagaagcaaaaaggaattttattaaaacagaacctggc
tccgggttttttggctttcagcttggaccttccccaaatggtccaaaatctggccttgtg
tctgtagcaattactttacatcccacagctgcagagaatattggcaacatagtagctgca
ttttccagcctcctgcatgtcagaattccaaacagttatgaagtcagtagtgccccagat
gttccttcttcagtgggaatgatgaacactcccagagcaaatccagccttcgagtacaga
cagcagctcttgcttcatggtccccagccaggcactgtcggctctcttggattcatgggg
ccttatggactcaaacaacctaacatgccatttccaccaagtggtaatggtttggcaggt
tataaggctcacagttccagtatgacggatagttccgtgctgaggccacagtggtgttcc
cattgcaaagtggtggttctgggcagtggtgtgcggaagtctttcaaagagccacctttc
ctgaagcaggattccagagagaggtctgagagaatggagaaagatgttgtcttctgtagc
aataactgctttgtcctctactcagcgtccatgcaagcaaaaaattcagagagcaaggaa
tcaattccttccttaccacagttccacatgaaggaggctccccccaaagggttccatcag
tataacaacaacatctccacactggatgtgcactgtctccctcagttccaggaaaaggtt
tctccaccatcatctccccttattaccttccctcccgcttttgaagcagctagggtggag
ccaaaaccagacgagctgaaggtaaccgtgaaactcaaaccccgtttgagaacaataccc
aatggtcttgatgactgtcgaccattaaataagaagtggaaaggaatgaagtggaagaaa
tggaacatacagattgtgattcctaaaggaaccttcaggcctccttgtgatgaggagata
gatgagttcctcaggaaactgggcacaaccattaaaccggatcctgtacccaaggactac
cgaaagtgttgcttctgtcatgaagagggtgatgggttaacagatggaccagccagactt
cttaaccttgacttagacctttgggtccatttgaactgtgcgctttggtcaacggaggtc
tatgagacacaagctggtgccttaataaatgtggagcttgccctgcggaggggcttgcaa
atgaaatgcacgttctgtcacaagatgggcgccaccagcggctgtcacaggttaaggtgc
accaatatttatcactttacctgtgccattaaagcacaatgcatgttttttaaagacaaa
accatgctttgccccatgcacaaaccaaagggagctcacgagcaagaactcagctatttt
gcagtcttcaggcgggtctacgtccagcgcgacgaagtccgccagattgccagcattgta
caacggggggaccgagaacacactttccgggtgggaagccttatcttccacactattggc
cagctgttgccgcaccagatgcaggccttccactcctccagggtactctaccctgtgggc
tatgaggccagccggttatattggagtacacggtatgccaaccgcagatgtcgctacctg
tgttctattgaagagaaggacggccttcccctttttgtgatcaggattactgaacaaggc
catgaagatgtggttcttaccgactcatacccaaaaggtgtttgggataaagtcctggat
cctgttgttgctgtaaggaagagttctgaaatgctccagctctttcctgcgtatctgaag
ggcgaagacctctttggtttgactgtctctgcagtggcaagaatagcagaatctcttcct
ggggttgaggcttgtgagaattacaccttccgctatggccgaaacccactcatggaactt
cctctggccatcaaccccaccggctgtgcccgctctgagccgaaaatgagtacccatgtc
aagaggtttgtgttaaggcctcataccctgaatagcaccagcacttcaaagtcatttcag
agcacagttaccggagaactgaatgcaccttacagtaaacagtttgttcattcaaagtcc
tcacagtaccgaaaaatgaagactgaatggaaatccaacgtgtatttggcacgttcacgt
attcagggcctgggcttatatgctgctagagacattgaaaagcacaccatggtcattgaa
tatattggaaccatcatccgcaacgaggtagccaacaggaaagagaagctgtatgaatct
cagaatcgtggggtgtacatgttccgcattgacaatgaccatgtcatcgatgccacattg
acgggaggccctgcaaggtatattaaccattcctgtgcaccaaactgtgtggctgaggtg
gtcacctttgaaaggggacataagattatcatcagctccagcaggagaatccagaaagga
gaagagctctgttatgactataagtttgattttgaagacgaccagcacaagattccatgt
cactgtggagctgtaaactgccggaaatggatgaactag

KEGG   Gekko japonicus: 107123351Help
Entry
107123351         CDS       T04299                                 

Gene name
EZH1
Definition
(RefSeq) enhancer of zeste 1 polycomb repressive complex 2 subunit
  KO
K17451  [histone H3]-lysine27 N-trimethyltransferase EZH1 [EC:2.1.1.356]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107123351 (EZH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107123351 (EZH1)
Enzymes [BR:gja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.356  [histone H3]-lysine27 N-trimethyltransferase
     107123351 (EZH1)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107123351 (EZH1)
   Polycomb group proteins
    PRC2-EZH1 complex
     107123351 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 107123351
NCBI-ProteinID: XP_015282077
LinkDB All DBs
Position
Un
AA seq 753 aa AA seqDB search
MAQQVAEPTTSLANLGQRKVEIPAPPTSKCILYWKRKVKSEYMRLRQLKRFQANMGAKAL
FASNYAKVQEKTNILNEDWKRLRVQPVQSMKLVRGHPFLKQCTIESLFPSFTTQTLFMRT
LNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGE
EEMLSTSVLISDAVFLELVDALNQYSEEEEEGHDAAEGKLEAGKEELPVTRKRKRLSVES
SKKCPKKHFPNDMIFTAISSMFPENGFPEDMKERYRELTEESDPNVLPPQCTPNIDGPCA
KSVQREQALHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKSRETKIETEPCGPDCFLWLE
GAKEFAVLRNQRSKCSGRRRRRAPALNASSSSSASTSTSTEAKEGDSDRDTGNDWASSSS
EANSRCQTPTKQKLSPAVSQPVLSDVPLEPVEWSGAEESLFRVFHGTYFNNFCSIARLLG
TKTCKQVFQFAVKESLITKLPTNELLNPSQKKKRKHRYNSSTQVYNYQPCDHPEHPCDSN
CPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEH
WDSKVVSCKNCSIQRGLKKHLLLAPSEVAGWGTFIKEAVQKNEFISEYCGELISQDEADR
RGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAK
RAIQAGEELFFDYRYSQADALKYVGIERETDIM
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaggtggctgaacccacaacatccctggccaacctgggacagaggaaagtg
gagattccagctccacctacatcaaaatgcatcctttattggaaaaggaaagtcaagtca
gaatacatgcgccttaggcagctcaagaggtttcaggcgaacatgggagcaaaggctttg
tttgcctctaactatgcgaaggtacaagaaaagacaaacatcctgaatgaggactggaag
aggctccgagttcagcctgttcagtcgatgaagctggttcggggacatcctttcctcaaa
cagtgcacgattgagagcctcttccccagcttcaccacacagaccttgttcatgcggact
ctcaacactgtggccctggtgcccatcatgtattcctggtccccactccaacagaatttc
atggtggaggacgaaactgtcctgtgcaacatcccctacatgggggacgaggtgaaagag
gaagacgagaccttcatcgaggagctcatcaacaactatgatggcaaagtgcacggagag
gaagaaatgctgtctacttcagtcctcatcagcgacgctgtgtttctcgagctggttgac
gccctgaatcagtactccgaggaggaggaggaagggcacgacgccgccgagggcaagctg
gaagccgggaaggaggagctgcccgtcactcggaagagaaagcggctttccgtggaaagc
agcaagaaatgtcccaagaagcactttccaaatgacatgatctttactgctatttcatca
atgttccctgaaaatggttttccagaggatatgaaggagagatacagagaactgacggaa
gagtcggacccgaatgtgctcccgccacagtgcaccccgaacatcgatgggccgtgtgcc
aagtccgtacagcgtgagcaggccctgcactccttccacactcttttttgtaggcgctgc
ttcaagtacgactgcttcctccacccgttccatgcgacgcccaacgtgtacaagcggaag
agcagagagaccaaaattgagacagagccttgtggtccagactgcttcttatggctggag
ggagccaaggagttcgctgtgctgcgcaaccaacggtccaagtgctctggacggcgccgc
cgcagggcccccgccctcaacgcctcctcttcctccagtgcttccacctccacgagcacc
gaagccaaggaaggcgacagcgaccgagacacgggcaacgactgggcctccagttcctcg
gaggccaactcgcgttgccagacaccgacgaagcagaagctgagccccgccgtctcgcag
ccggtcctgtcagacgtgccgctggagcccgttgagtggtcgggggcggaggagtccctc
ttccgtgtcttccacggaacctacttcaacaatttctgctccatcgcgagactgctggga
accaagacctgcaagcaggtgtttcagtttgccgtgaaggagtccttgataacgaagctg
cccaccaatgagctcctgaatccctcccagaagaagaagcggaagcacaggtataattca
tccactcaagtgtacaactatcagccctgtgaccaccctgagcacccttgcgacagcaac
tgcccttgcatcatgacccagaatttctgcgagaagttctgccagtgcaatccggactgc
cagaaccgcttccctggctgccggtgcaagacccagtgcaacaccaagcagtgtccgtgc
tacctggcggtgcgggagtgcgatccagacctctgcctgacttgtggggcctcggaacac
tgggactccaaggtggtttcctgcaagaactgcagtatccagcggggcctgaagaagcac
ctgctgctggctccctccgaggtggctggctggggaaccttcatcaaggaggccgtgcaa
aagaatgaatttatctcggagtactgcggggagctcatctcccaagacgaggcggatcga
cgcgggaaggtctatgacaaatatatgtccagtttcctcttcaacctcaacaatgatttc
gtggtcgacgcgacccgcaaaggcaacaagatccgctttgccaaccactctgtcaatccc
aactgctacgccaaagtggtgatggtgaatggagaccaccgcattgggatctttgccaag
agagccatccaggcaggcgaggagctcttctttgactacaggtacagccaggcagatgca
ctcaagtatgtcggcatagaacgagagacggacatcatgtaa

DBGET integrated database retrieval system