KEGG   Gekko japonicus: 107105501Help
Entry
107105501         CDS       T04299                                 

Gene name
CBL
Definition
(RefSeq) Cbl proto-oncogene
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
gja  Gekko japonicus
Pathway
gja04012  ErbB signaling pathway
gja04120  Ubiquitin mediated proteolysis
gja04144  Endocytosis
gja04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107105501 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107105501 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107105501 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107105501 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107105501 (CBL)
   04121 Ubiquitin system [BR:gja04121]
    107105501 (CBL)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107105501 (CBL)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    107105501 (CBL)
Ubiquitin system [BR:gja04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    107105501 (CBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 UBA zf-RING_UBOX zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 107105501
NCBI-ProteinID: XP_015260971
LinkDB All DBs
Position
Un
AA seq 868 aa AA seqDB search
MPDAQKACVVRLCQSPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRV
FMENLMKKTKQTISLFKEWKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGD
TFRITKADAAEFWRKAFGEKTIVPWKMFRQALHEVHPISSGLEAMALKSTIDLTCNDYIS
VFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSC
TRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLYPDGRNQNPDLTGLCEPTP
QDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQAQGYKLSG
AAVPGLFGPAGTEPIVVDPFDPRGGGGLLRQSAEGAPSPNYDDDDDDRADESLFMMKELA
GAKVERPPSPFSMAPQATLPPVPPRLDLLQQRVSNPPGASSPGTTSKAMPGSLHKDKPLP
IPPTHRDLPPPPPPDRPHAITASDTRPQRRPLPCTPGDCPSRDKLPALPSNRQGELWPSR
PIPKALGVALSPSEPWANRELTNRHSLPFSLPSQMDSRADVHRHGSTLSLDTTVTQPSGL
PAGSDSDLSKMKPSSSANAIYSLAVRPLAASKLPPGEHSENAEDTEYMSPSSLPLVPPGP
AVPKLEAKLPLEMTPSSRVLECDEELDGCTYEAMFNIHSQAGPSGSETASIPEGGDMAGA
NASNGPEESENEEDGYDVPRPPIPLTVARRTLSDISNAASAFSRVSLDGDALTGFSENSQ
VPERPPKPLPRRINSERKAGSCLPGGMAGPMAASASPQLSGEIENLMSQGYSYQDIQKAL
LIAHNNIDMAKNILREFVSISSPAHVAT
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgccggacgcacagaaggcttgcgtcgtacgtttgtgtcagagccccaagctggcacta
aagaacagtccgccctatattctagacctgctccctgacacatatcagcacctgcgaacc
atcttgtcacgctacgaggggaagatggaaactttaggagagaatgaatacttcagggtg
ttcatggaaaacttgatgaagaagacgaagcagaccatcagcctctttaaagaatggaaa
gagagaatgtacgaagagaattcccagcctaggcgcaaccttacaaagctgtccctgatc
ttcagccacatgctagcagaactgaaaggcattttcccgagtgggctcttccagggtgac
acattccggatcacaaaggctgatgcggcggagttctggaggaaagcttttggggaaaaa
accattgtcccctggaagatgttccgccaggccctccacgaagtgcaccctataagttca
ggccttgaggcgatggcgctaaaatcaacgattgacttgacgtgcaatgattacatttct
gtgtttgaatttgatatctttacgcgactgttccagccctggtcctctttgctcaggaac
tggaacagcctggcagtgactcacccgggctacatggcattcttgacgtacgatgaggtc
aaagcgcggcttcagaagttcattcacaaacctggcagttacattttccggctgagctgt
acacggctgggtcagtgggcgatcggttacgtcactgccgatggaaacatccttcagaca
atcccccacaacaaacccctctttcaagcactgattgacggcttcagggaaggcttctac
ttatatcctgatgggcgaaatcagaaccctgacttgactggtctctgtgaacccacacct
caggatcacattaaagttacacaggagcaatacgaactgtactgtgagatgggctccacc
ttccagctctgtaaaatctgcgccgaaaacgacaaggatgtgaagatcgaaccctgcggc
cacctcatgtgcacttcctgtctcacagcgtggcaggcacagggttacaaattgtctggg
gcagcggtccccggcctttttgggcctgcaggcaccgagcccattgtcgttgacccattt
gatcccagagggggaggggggctgctgcggcaaagcgcagagggagccccctccccaaac
tacgacgatgacgacgacgacagggccgacgaatcgctgttcatgatgaaagagctggct
ggcgcaaaggtggagcgtcctccttctcccttttcaatggctccccaggcaacactcccc
ccggtgcccccacgattagaccttctgcagcagcgcgtctccaacccccccggagcttcg
agtccaggaaccacttctaaggccatgcccggttctcttcacaaagacaaacctttgccg
attcccccgacgcatcgagatctcccgccgcctcctcctccggaccggccacatgccata
acggcgtcagacacgcggcctcagcggcggcccctgccgtgcactccaggagactgccct
tcccgggacaagctgcccgccctgccttccaaccgccagggggagctgtggccgtcgcgg
ccgatccccaaagctctaggggtggccctgagtcccagtgagccctgggcaaatagggag
ctgaccaaccgccactcgctcccgttctcgctgccttcccagatggattccagagcggac
gttcaccggcacggaagtaccctcagcctggacaccaccgtgactcaacccagtgggctt
ccagccggctcggacagtgacctttctaaaatgaaaccctcctcttctgccaatgccatc
tattctcttgctgtaaggccattggctgcatcaaagctgccccccggagagcactcggaa
aacgccgaagacaccgagtacatgtcgccatcctccctgcccctggtgccgcctggccct
gccgtaccaaagctggaggctaaattgcctttggagatgactccgagttcacgagtgttg
gagtgcgacgaggaactggacgggtgtacttacgaagccatgttcaacatccactcccag
gccgggccttccggctcggagacagccagcattcccgaggggggagacatggcaggcgcc
aatgcaagcaacggacctgaagagtcagagaacgaagaagatggttacgacgtgcccagg
cctcccatccccttgactgtggctcgtcgcacgctgtccgatatctccaatgcagcctct
gccttcagccgtgtgtcgctggacggggatgctctcacaggtttctccgagaactcccag
gtgcccgagaggcccccgaagcccttgccgcggaggataaactccgagcggaaagcgggc
agctgcctgccggggggcatggccgggcccatggccgcctccgcctccccccagctctcc
ggcgagatcgagaacctcatgagccaaggctactcctatcaggacatccagaaagcgctg
ctcatcgcccacaacaacattgacatggccaaaaatatcctccgggagtttgtctccatc
tcctcccccgcccacgtggccacatag

DBGET integrated database retrieval system