KEGG   Gekko japonicus: 107105520
Entry
107105520         CDS       T04299                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
gja  Gekko japonicus
Pathway
gja04310  Wnt signaling pathway
gja04510  Focal adhesion
gja04520  Adherens junction
gja04916  Melanogenesis
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107105520 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107105520 (CTNNB1)
   04520 Adherens junction
    107105520 (CTNNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107105520 (CTNNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107105520 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 107105520
NCBI-ProteinID: NP_001310414
UniProt: V5RDH2
LinkDB
Position
Un
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEDDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTSDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLALDIGAQGEPLGYRPDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggcaactcaagctgacttgatggaattggacatggcaatggaaccggacagaaaggca
gctgtcagccactggcagcaacaatcatacctggattctggtatccactctggtgccacc
acaacagctccctctctgagtggcaaggggaacccagaggaagatgatgttgataccacc
caagttctatatgagtgggaacaaggattctcccagtccttcacccaggaacaagttgct
gatattgatgggcaatatgctatgacccgagcacaaagggtgcgtgctgccatgttccct
gaaacgctggatgaaggcatgcagatcccgtcaacacaatttgatgctgctcatccaaca
aacgtgcaacgccttgctgaaccttctcagatgttaaaacatgccgtggttaatttgata
aactaccaagatgatgcagaactagcaacccgtgccatcccagaattgaccaaactgttg
aatgatgaggaccaggtggtggtgaacaaggctgcggttatggttcatcagttgtccaaa
aaagaagcctctcgccatgctatcatgcgctctcctcagatggtatctgccattgtgcgt
actatgcagaacacaagtgacgtggaaacggcccgttgtactgcaggtacactacacaac
ctctcccatcatcgtgaagggttgctggcgatcttcaaatctggaggcattcctgctttg
gtgaaaatgcttggttctccagtagattctgtactcttctatgccattacgactctacac
aatcttctgctacatcaagaaggtgccaaaatggccgttcgtctagcggggggcctgcag
aagatggtggccctgctcaacaagacaaatgttaagtttttggctattacaacagactgc
cttcagattcttgcttatggcaatcaagaaagtaagcttatcattctagcaagtggtgga
ccccaggctctagtgaacataatgaggacgtatacctatgagaaattactgtggaccaca
agtagagtgctgaaggtgttgtcagtctgctctagtaacaaacctgcaattgttgaagct
ggtgggatgcaagccttaggactccatcttacagatccaagtcagcgtcttgttcagaat
tgtctctggactcttagaaatctctcagatgctgcgactaagcaggaaggaatggagggt
cttctgggaacccttgtgcagcttttaggatcagatgatatcaatgttgtaacctgtgct
gctggtatcctttctaaccttacctgtaacaactacaagaataaaatgatggtgtgccag
gttggtggcattgaggctcttgtgcgcacagttcttcgggctggtgacagggaagacatc
actgaaccagctatttgtgcgctccgtcacctcactagtcggcatcaggaagctgagatg
gcccagaatgcagtgcgtctccattatggacttccagtggtggtaaaactcttgcatcca
ccttctcactggcctctgatcaaggctactgttggactgatccgcaatcttgctctctgt
ccagcaaatcatgctcctttgcgtgaacaaggtgctattccaagactagtccagttgctg
gttagagcacaccaggatacccagcgtcgtacttcaatgggtggcacacaacagcagttt
gtggagggtgtgcgtatggaggaaatagttgaaggctgcactggagcccttcatatcctg
gctagagatgtccacaatcgtattgtaataaggggtctaaataccattccactgtttgtg
cagctgctgtattcccctattgagaatattcagagagtggctgcaggagtattgtgtgaa
ctggctcaagataaggaagctgcagaagccattgaagcagaaggagctacagctccactg
acagaacttcttcattctaggaatgagggtgtggcaacatatgcagctgcagtgttgttt
agaatgtctgaggataagccacaagactataagaaacgactttcagttgaattgacgagc
tctctattcaggactgaaccaatggcttggaatgagactgctgatcttgcacttgatatt
ggtgcccagggagaacctcttggatatcgcccagatgatcctagttaccgttctttccac
tctggaggatacggtcaggatgccttgggtatggacccaatgatggaacatgaaatgggt
ggccaccaccctggtgctgactacccagttgatgggctgccagatctaggacatgcccag
gaccttatggatgggttgcctccaggtgacagtaatcagttggcctggttcgatactgac
ctgtaa

DBGET integrated database retrieval system