KEGG   Gekko japonicus: 107105754
Entry
107105754         CDS       T04299                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107105754 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107105754 (NFKB1)
   04218 Cellular senescence
    107105754 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    107105754 (NFKB1)
   04620 Toll-like receptor signaling pathway
    107105754 (NFKB1)
   04621 NOD-like receptor signaling pathway
    107105754 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    107105754 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    107105754 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    107105754 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107105754 (NFKB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107105754 (NFKB1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107105754 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107105754 (NFKB1)
Transcription factors [BR:gja03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107105754 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 107105754
NCBI-ProteinID: XP_015261255
LinkDB
Position
Un
AA seq 944 aa
MFGMDTYMGMNVLINNAGIITSDLPIRTADGPYLQIVEQPKQRGFRFRYVCEGPSHGGLP
GASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKQPHLHAHSLVGKHCENGICTVNAGPK
DTVVGFPNLGILHVTKKRVFDTLEARMIDCCKKGYNPGLLVHPELSYIQVEGGGDRQLTE
REREIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRTLHPVLSDPIYDSKAPNASNL
KIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEDENGGVWEGFGDFSPTDVHRQFA
IVFKTPKYRDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNF
SDSYGGSGAGAGGGGMYGGGGNAGGGGAGSGYGYTPYGYSSYGGMHFHSSTNKAGAGMKH
GLSNDMPKKEDGKSCCKSSKKHNVKFKEKGEVEEKSKTRTCTALKPEDAEICLQDSFFLE
KAMELAKRHANALFDYAVTGDVKMLLAVQRHLTTVQDENGDNVLHLAIIHLHMELLRNLL
EVIADFNADDVLNVRNDLYQTPLHLAVITKQSGGVKALLRGGADVTLLDRHGNSVLHLAA
NQGDEKVLNVLLHHKEASLMKDLPNSEGLNAIHLAVMANSVSCLRRLIAAGADVNAQEQK
SGRTALHLAVEQGNISLAGCLLLEGDANVDSTTYDGTTPLHIAAGRGSTKLTALLKAAGA
NPYTENFEPLFELEDGNDRDSEDEEAVPRATPLDMATSWEVYDILNGKPCKSKVASDDLL
TQGNMKELSEDVKLQLYKLLEVPDLNKNWSMLAQKLGLGILNNAFRLSPSPSKTLLDNYE
VSGGTIGELVDALRDMDYPEAAEVIQKAMSISSSQSNQEETKGEMCCLSFQDTESICDSG
VEISLRKLSFTYSESFTSESPVTLKKLAPGYGQDNLLQGKMEAT
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgttcggaatggacacatacatggggatgaatgtgctgattaataatgcaggcataata
acatctgatctaccaattcgtacagctgatgggccatatcttcaaatcgttgagcaacct
aagcagaggggatttcgtttccgatatgtttgtgaaggaccatcacatggtggacttccg
ggagcttctagtgaaaaaaacaaaaaatcatatcctcaagttaaaatctgcaattacgtc
ggccctgcaaaagtaattgttcagttggtcacaaatggaaaacagccccacttgcatgct
cacagcttggtggggaaacactgtgagaatggaatatgcacagtgaatgcaggaccaaaa
gatactgtggtaggctttccaaatttgggaatattgcatgttacaaagaagagagtgttt
gacacactagaagcacgcatgattgattgctgtaaaaaaggctacaacccgggacttcta
gtgcaccctgaactgagctatatacaagtggaaggtggaggggacagacaactcacagag
agagagagagaaatcattcgccaggcagcacttcagcagactaaagagatggacctcagt
gtggtgcggctcatgttcacggctttccttcctgatagcactggcagctttaccagaaca
cttcatcctgtcttatctgatccgatatatgacagcaaagcccccaatgcatccaactta
aaaattgtacgaatggaccgcacagcaggctgtgtgactggaggagaagagatttacctt
ctttgtgacaaagttcagaaagatgatattcagatccgcttctatgaagaagatgaaaat
ggtggtgtctgggaagggtttggagatttttcccctactgatgtgcacagacagtttgct
atagtgttcaaaacacccaagtaccgagatgtcaatatcacaaagccagcatccgttttt
gtccagctacggaggaaatctgatctagagacaagtgaaccaaagccttttctgtactat
cctgaaatcaaagataaggaagaagtgcagagaaaacggcagaaactcatgcctaacttt
tctgatagttacggtggaagcggagcaggtgctggaggaggtggaatgtatggaggagga
ggaaatgctggtggtggaggggctggatcaggttatgggtacacaccatatggttattct
agttatggaggaatgcatttccattccagcacaaacaaggccggtgctggaatgaaacat
ggactctcaaatgacatgcctaaaaaggaagatggcaaaagttgctgcaagagcagtaaa
aagcacaatgtgaaattcaaggaaaaaggagaagttgaagagaagagcaaaaccagaact
tgcacagctctcaagccggaagatgcagagatttgtttacaagatagtttctttttggag
aaggctatggagcttgctaagcgtcatgccaatgctctttttgactatgcagtaacggga
gacgtgaagatgctactggctgttcagcggcacctgaccacagtccaggatgaaaatggt
gacaatgtccttcacttagcaattattcatcttcacatggaactgctgagaaacctctta
gaagtgatagcagacttcaatgccgatgatgttctcaatgtgagaaatgacctttaccag
actcctctacacttggctgtcatcacaaagcagtcaggaggggtaaaagccttgctgaga
ggtggggcggatgtgactcttttggatcggcatgggaattcggtcttgcacctggcagcc
aatcaaggggatgagaaggtgttgaacgttctgcttcatcacaaagaggcatctctgatg
aaagaccttcctaacagtgaaggtctgaatgctatccacctggctgtaatggctaatagc
gtgtcatgtctcagacgcctcattgctgctggagctgacgtcaacgcccaggaacaaaaa
tctgggagaactgccttgcacctggctgttgaacaaggaaatatctccttggcaggttgc
cttctccttgagggcgatgccaatgttgacagcacaacgtatgatggaaccactccactt
catatagcagctggaagaggttctacgaaactgacagcacttctcaaagctgcaggtgca
aatccctacactgagaactttgagccactgtttgaactagaagacgggaatgatagagac
agtgaagatgaagaggccgtccctcgagcaacacctttggatatggcaacgagctgggag
gtgtatgatatcctgaacggcaaaccctgtaagtcaaaggtggcttctgatgacctattg
acacaagggaacatgaaagaactgagtgaggatgttaaattacagctttacaagttgctt
gaagtacctgatctaaacaaaaactggtccatgttggctcagaaactgggcctagggata
ctaaacaatgctttccgattgagtccttctccatcaaaaactcttctggataattatgag
gtgtctggaggtacaataggagagctggttgatgccttgagagacatggactacccagaa
gctgctgaagttatccagaaagcaatgtccatctcatctagccagtccaaccaagaggag
acaaaaggtgaaatgtgctgcctcagcttccaagacactgaaagcatttgtgacagtggg
gtagagatctccctccgcaaactcagctttacatattccgagtctttcaccagcgagtca
ccagtgacacttaagaaactggctccaggatacggacaagacaacttactacagggcaaa
atggaagccacttaa

DBGET integrated database retrieval system