KEGG   Gekko japonicus: 107105898Help
Entry
107105898         CDS       T04299                                 

Gene name
IDH1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gja  Gekko japonicus
Pathway
gja00020  Citrate cycle (TCA cycle)
gja00480  Glutathione metabolism
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja01210  2-Oxocarboxylic acid metabolism
gja01230  Biosynthesis of amino acids
gja04146  Peroxisome
Module
gja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gja_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107105898 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107105898 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107105898 (IDH1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     107105898 (IDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 107105898
NCBI-ProteinID: XP_015261431
LinkDB All DBs
Position
Un
AA seq 417 aa AA seqDB search
MSKKIHGGPVVEMQGDEMTRVIWDLIKEKLIKKFPYVDLELHSYDLGIENRDATNDKVTI
EAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIP
RLVSGWVKPIIIGRHAFGDQYRATDFVVPGPGKVEMTYTPKDGGKPITYTIHNFENCGGV
ALGMFNLDQSIKDFAHSSFQMALTKSWPLYMSTKNTILKKYDGRFKDIFQEIYEKEYKSK
FEAQNIWYEHRLIDDMVAQALKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICP
DGKTVEAEAAHGTVTRHYRLHQKGQETSTNPIASIFAWTRGLAHRAKLDKNAELQNFATA
LEEVCVETIEAGSMTKDLAACIKGLPNVQRSDYLSTFDFLDKLAENLKAKLTSQPRL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaatccatggcgggcctgttgtcgagatgcagggggatgaaatgactcgt
gttatatgggacctgattaaggaaaaactcataaaaaaatttccctacgtggatctggaa
ctccacagctatgacttgggcatcgagaaccgggacgcaacaaacgacaaagtcaccata
gaagctgccgaagccatcaagaagtacaatgtaggagtcaaatgtgccacgatcactccc
gacgagaagagagtagaagaattcaagctgaagcagatgtggaagtctccaaacgggacc
atcagaaacattctgggcggcacagtgttccgggaagccatcatctgcaaaaatatcccc
cggctggtatccggatgggtgaaacctatcatcattggccgtcacgcgtttggagaccaa
tatagagccacagattttgtcgtacctggccctggaaaggtagagatgacctacacacca
aaggatggaggaaaaccgataacttacacaatacataactttgaaaactgtggaggtgtg
gctctggggatgttcaacctggaccagtccatcaaggattttgctcacagttccttccag
atggcactgaccaaaagctggcctctgtacatgagcaccaaaaacactattttgaagaaa
tacgatggccgatttaaagacatctttcaggagatttatgaaaaggagtacaagtcaaag
tttgaagcccaaaacatctggtacgagcatcggctcatagacgacatggtggcccaagcc
ctgaaatccgagggagggtttatctgggcctgcaagaactacgatggtgatgtgcagtct
gactcggttgcacaaggttacggttccctgggaatgatgaccagcgtcctgatatgtcca
gacggcaaaacagtggaagctgaagctgcacacggcacagtgacccgccactatcgcctg
caccagaagggccaagagacgtccaccaaccctattgcctctatctttgcctggaccaga
ggtctcgctcacagagctaagttggataaaaacgccgagctccagaacttcgccaccgcc
ctggaggaagtgtgcgtggagaccatcgaggccggctccatgacgaaagatctggctgct
tgcattaaagggctcccaaacgtgcagcgctctgactacttgagcacatttgatttcctg
gacaaacttgccgaaaacctgaaggcaaagctgacctctcaaccgagactttaa

KEGG   Gekko japonicus: 107125389Help
Entry
107125389         CDS       T04299                                 

Gene name
IDH2
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 2, mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gja  Gekko japonicus
Pathway
gja00020  Citrate cycle (TCA cycle)
gja00480  Glutathione metabolism
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja01210  2-Oxocarboxylic acid metabolism
gja01230  Biosynthesis of amino acids
gja04146  Peroxisome
Module
gja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gja_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107125389 (IDH2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107125389 (IDH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107125389 (IDH2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     107125389 (IDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 107125389
NCBI-ProteinID: XP_015284307
LinkDB All DBs
Position
Un
AA seq 400 aa AA seqDB search
MDGDEMTRIIWAFIKEKLILPNVDVQLKYFDLGLPYRDKTGDQVTIDSALATQKYSVAVK
CATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKAITIGR
HAHGDQYKATDFVVDRPGAFKMIFTPKDGSGPKEWEVYNFPGGGVGMGMYNTDESISGFA
HSCFQYAIQKKWPLYLSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKLRIWYEHRLIDD
MVAQVLKSVGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVT
RHYREHQKGNPTSTNPIASIFAWTRGLEHRGKLDSNPDLIKFAQTLEKVCVQTVESGTMT
KDLAGCIHGLSNVKLNEHFVNTTDFLDAIKNNLDKALGKQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatggcgatgagatgacacgcatcatttgggccttcatcaaggagaagttgatcctg
cccaatgtggacgttcagctgaagtactttgacctgggcctgccctaccgggacaagacc
ggtgaccaggtcaccatcgactctgccctggccactcagaagtacagcgtggccgtcaag
tgcgccaccatcacccctgacgaggcacgcgtggaagagttcaagctgaagaaaatgtgg
aagagtcccaacggcacgatcaggaacatcctgggtgggacggtcttcagagagccaatc
atctgcaagaacattcctcgcctggtcccaggctggacgaaggccatcaccattggcaga
cacgcccatggcgaccagtacaaagccacggatttcgttgtggacaggcccggggcgttt
aagatgatcttcacccccaaggacggcagcgggcccaaggagtgggaggtgtacaacttc
cccggcgggggtgtcggcatggggatgtacaacaccgacgagtccatttcaggcttcgcc
cacagctgcttccagtacgccatccagaagaagtggccgctctacctgagcaccaagaac
accatcctcaaggcctacgatgggcgcttcaaggacatcttccaggagatctttgacaag
cactacaagactgactttgacaagctccggatctggtacgagcaccggctgatcgatgac
atggtggcccaggtgctgaagtcggtggggggctttgtctgggcttgcaagaactacgac
ggggacgtccagtccgacattttggctcaaggcttcggctcgctgggcttgatgacttct
gtcctcgtctgcccggacggaaagaccatcgaagcagaggcggctcacggcacggtcacg
cgccattaccgggagcaccagaagggcaaccccaccagcaccaaccccattgccagcatc
ttcgcctggacccgcggcctggagcacagaggcaaactggacagcaatcctgatctcatc
aagtttgcccagaccttggagaaggtctgtgttcagacggtggagtcggggaccatgacc
aaggacttggccggctgtatccacggactgagcaatgtgaagctgaacgagcactttgtg
aacaccacggacttcctggacgccatcaagaacaacctggacaaagccctcggcaagcag
tag

DBGET integrated database retrieval system