KEGG   Gekko japonicus: 107105918Help
Entry
107105918         CDS       T04299                                 

Gene name
MFNG
Definition
(RefSeq) MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
gja04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107105918 (MFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107105918 (MFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107105918 (MFNG)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     107105918 (MFNG)
Glycosyltransferases [BR:gja01003]
 Glycan extension
  O-Glycan
   107105918 (MFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 107105918
NCBI-ProteinID: XP_015261452
LinkDB All DBs
Position
Un
AA seq 351 aa AA seqDB search
MYRQWCLIRAIWGVALLLISMVLLSVRRYGIPVAVNDQRSGEGTAGVSEQPETILVDVMD
YIGRDEKLKVHVPHSTVGKGLVLRELFIAVKTTRKFHQSRMRLLLLTWISRVKEQTYVFT
DEEDDELQGKLGDHVVFTNCSSEHSHPALSCKMAAEFDAFLASGLSWFCHLDDDNYLNPQ
ALLKLLSSYSPDQDVYIGKPSLNRPIRASETLPDNQTKSVYFWFATGGAGFCISRKLATK
MAPWASGGNFLITSERIRLPDDCTVGYIVECKLGGRLLANNLFHSHLENLQLMQKDQLAK
QVTLSYGIFEKKLNAIKLAGPFSQHDDPSRFRSLHCILYPDTSWCPQPVTQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggcagtggtgtctcatccgtgccatttggggagtcgccctccttctcatcagc
atggtgctcctttccgtgaggcgttacggcattccagtggcggtcaacgaccaaagatct
ggagaagggacagctggtgtctcggaacagccagaaacaatattggtggatgtcatggac
tacatcggcagagatgaaaaactcaaggttcacgtaccacattcaacagttgggaaaggc
ctggtgcttagagaactcttcattgctgtaaagacaacaaggaagttccaccagtccaga
atgagattattgctacttacctggatatctcgggtcaaggaacagacatatgtcttcacg
gatgaagaagatgatgaactgcaaggaaaattgggtgaccatgtggtgttcaccaactgc
tcttcagaacacagccatccggcactctcttgcaaaatggctgccgagtttgatgctttt
ttggctagtggcctgagttggttttgccacctggacgatgacaactatctgaatccacaa
gctctgctgaaactcttgtcctcttactctccagaccaagacgtgtacattgggaagccc
agcttgaacaggcccattcgtgcctcggaaaccttgcctgacaaccagacaaagtcagtg
tatttttggtttgccactgggggtgctggattctgcatcagccggaagttggccaccaag
atggccccttgggcaagtggtggcaacttcctgatcacttcagagcgcatccgacttcca
gatgactgcacggtgggctatatcgttgagtgcaagttagggggccgcctgcttgctaat
aacctcttccattctcacctggagaacctacagctaatgcagaaagaccaactagccaag
caggtcacacttagctacggcatttttgaaaagaagctcaatgctatcaagctagctggc
cctttctcccagcatgatgacccttccaggttccgatcccttcactgcatcctctatcca
gacacttcttggtgcccacagccagtcacccagtga

KEGG   Gekko japonicus: 107118125Help
Entry
107118125         CDS       T04299                                 

Gene name
RFNG
Definition
(RefSeq) RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
gja04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107118125 (RFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107118125 (RFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107118125 (RFNG)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     107118125 (RFNG)
Glycosyltransferases [BR:gja01003]
 Glycan extension
  O-Glycan
   107118125 (RFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe
Motif
Other DBs
NCBI-GeneID: 107118125
NCBI-ProteinID: XP_015275856
LinkDB All DBs
Position
Un
AA seq 402 aa AA seqDB search
MSCSCIWFSKICFLLSVIFCAILLLLIPKFQANWRPRSYPQPHPPSVFSASNKSEVQSQQ
AESNSVDNLNDETNNIVPFVKEELIQEWTPHVIDTGRSSLKANSKMNESPSNPWYNRVNH
VGPDNISAKEKLELKDIFIAVKTTRKYHKTRLNLLFQTWISQAQGQTFIFTDWEDPELRH
RAGDHMINTNCSAVHTRQALCCKMSVEYDKFLESGQKWFCHMDDDNYVNLRNLLHLLSAF
SHSQDVYVGRPSLDHPIEAADHVRNDGSTTVKFWFATGGAGFCISRGLALKMSPWASLGS
FISTAERIRLPDDCTIGYIIEGLLEVKLHHSPLFHSHLENLQRLRGEAVFKQVTLSYGGP
ENKHNVVSVEEMFNVQQDPTRFRSVHCLLYPDTAWCPTVTVK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagctgttcctgcatttggttcagtaagatctgcttcctgctctctgttatcttttgc
gcaatcctcctcttattaatccccaaattccaggctaattggagacctagaagttatcca
cagccgcatccaccttcagttttcagtgcttcgaacaagagtgaggtccagtcacagcag
gcagagtcaaattcagttgataatttgaatgatgaaactaacaacattgtaccctttgtg
aaagaggaactaatacaagaatggacccctcatgtcatagacactgggcgatccagcctg
aaagctaacagcaagatgaatgagagcccaagtaatccatggtacaatagggtgaatcat
gtgggacctgacaacatctctgctaaggaaaagttggaattgaaggatatctttattgct
gtgaaaacaacacggaaataccataaaacaaggttgaacttgctcttccaaacatggatt
tcccaggctcaggggcagacctttatatttacagactgggaggatccagaactgcgtcac
agagcaggggatcacatgatcaacaccaactgctcagctgttcatacccgccaagcactc
tgctgcaagatgtctgtggaatatgataaatttcttgaatctgggcaaaagtggttttgt
cacatggatgatgacaactatgtgaatctgcgaaatctcctgcatctcctgtctgccttt
tcacacagccaagatgtctatgttgggagaccaagtctagatcatcccattgaagcagca
gatcatgtcaggaatgatggatcaaccactgtgaagttctggtttgccacaggcggagca
gggttctgtatcagcagaggtcttgccctcaaaatgagtccctgggctagcttggggagc
ttcatcagcactgctgagaggattcgcctccctgatgactgcacaattggctacatcatt
gaagggttgttggaagtgaagttgcaccacagccccttgttccactcacacctggaaaac
ctgcagcggctacgtggtgaagcggtgttcaaacaggttaccttaagctatgggggtcct
gagaacaaacataatgttgtgagtgtggaggaaatgttcaatgtacagcaagacccaact
cgattcagatctgtccactgtctactctatcccgacactgcatggtgccccactgtaaca
gtgaagtga

KEGG   Gekko japonicus: 107122012Help
Entry
107122012         CDS       T04299                                 

Gene name
LFNG
Definition
(RefSeq) LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
gja04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107122012 (LFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107122012 (LFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107122012 (LFNG)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     107122012 (LFNG)
Glycosyltransferases [BR:gja01003]
 Glycan extension
  O-Glycan
   107122012 (LFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 107122012
NCBI-ProteinID: XP_015280519
LinkDB All DBs
Position
Un
AA seq 345 aa AA seqDB search
MLKSCGKKLLLSLVGSMLTCLLMLVADPQKRQGLRLGGEPAGGFGAYFSQLSRSKRGARA
EDEEAAAAPRRPVEEIAPRDVFIAVKTTKKFHKARLELLLDTWIARDKDSTFIFTDGEDE
ELKKRTRNVINTNCSAAHSRQALSCKMAVEYDKFIESGRKWFCHVDDDNYVNVRTLVKLL
SSYPHTQDIYIGKPSLDRPIQAAERISENKMHPVYFWFATGGAGFCISRGLALKMSPWAS
GGHFMSTAEKIRLPDDCTIGYIIESVLGVKLIRSNLFHSHLENLHQVPKTEIHNQVTLSY
GMFENKRNSIHMKGAFSVEEDPSRFRSVHCLLYPDTPWCPLNVAY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagagctgcgggaagaagctgctcctctccctggtgggctccatgctgacctgc
ctgctgatgctggtggccgacccgcagaagcggcaggggctgcgcctgggcggggagccg
gcgggcggcttcggcgcctacttcagccagctgagccggagcaagcggggggcgcgggcc
gaggacgaggaggcggcggcggccccccggcggccggtggaggagatcgcgccccgggac
gtcttcatcgccgtcaagaccaccaagaagttccacaaggcccggctggagctcttgctg
gacacctggatcgcccgcgacaaggactcgaccttcatcttcacagatggggaagacgag
gaactaaagaagagaaccaggaacgtcatcaacaccaactgttccgctgcccacagccgc
caagccctgtcctgcaagatggcggtcgaatacgacaagttcatcgaatcggggaggaag
tggttttgccacgtggacgacgataactacgtgaacgtgcggacgctggtgaagctgctc
tccagttatccccacacgcaggacatctacatcgggaagcccagcttggacaggcccatc
caggcggccgagaggatcagcgaaaacaagatgcatccggtctacttctggttcgcgacg
ggcggagccggtttctgcataagccgggggctggcgctgaagatgagtccctgggccagt
ggcggtcacttcatgagcaccgcggagaagatccgcttgccagacgactgcaccatcggc
tacatcatcgagtctgtgctgggtgtgaagctcatccggagcaacctcttccactcccac
ctggagaacctccatcaggtgcccaagacggagattcacaaccaggtgaccttgagttac
gggatgttcgaaaacaagaggaactcaatccacatgaaaggcgctttctcggtcgaggag
gacccatccaggttccgctccgtccactgcctgctgtaccccgacaccccttggtgtccc
ctgaacgtcgcttactga

DBGET integrated database retrieval system