KEGG   Gekko japonicus: 107106036
Entry
107106036         CDS       T04299                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04020  Calcium signaling pathway
gja04144  Endocytosis
gja04510  Focal adhesion
gja04540  Gap junction
gja04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107106036 (PDGFRA)
   04020 Calcium signaling pathway
    107106036 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107106036 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107106036 (PDGFRA)
   04540 Gap junction
    107106036 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107106036 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107106036 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gja04090]
    107106036 (PDGFRA)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107106036 (PDGFRA)
Protein kinases [BR:gja01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107106036 (PDGFRA)
CD molecules [BR:gja04090]
 Proteins
  107106036 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE
Other DBs
NCBI-GeneID: 107106036
NCBI-ProteinID: XP_015261604
LinkDB
Position
Un
AA seq 967 aa
MGSSRRTFLILGYLLAGLWLASGQSLLPTIFPNKDEMVVQLNSPFTLKCSGDNELSWQHP
ISDGNDTIDIRSEENNSGLFVTLLEVGKASATHTGLYVCYYNHSQEEDVEVEGKEIYVYV
PDPAVPFVPTSPEDQIIFVTDVDESSVIPCRTSDRNAQVTLLNSEGKTVYAFYDHKQGFI
GNFSAGSYKNKGTITVEDIKIPSQKLVYTLNIPNASVEDTGNYECAAQHVINDVTKTQKI
VITVYDKGFIRLEPHFSLLEDVNLHGVKNFVLDVYAYPAPRMLWLKNNVTLIENLTEIVT
SSKQINETRYRSVLKLIRAKEEDNGNYTVIAQNEDEIQRYTFSLLVQVPAIIQDLVDIHQ
GSAVQTVKCLAKGTPLPDVEWLVCKDIKRCSNESSWTLLTNNISDITMDAHLDEKNAVES
QVTFQKVEETLAVRCMARNDLGTVTRELKLVAPTLRSELTVAAAVLVLLVIAIISLIVLV
IIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSGAFGK
VVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTK
SGPIYIITEYCFYGDLVNYLHKNRDNFLSRNPEKFKKDLDIFGMNSVDESNRSYVILSFE
NNGEYMDMKQAETTQYVPMLERKDRSKYSDIQRSLYDRPASYKKKSVLVAILLICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGXXXXXEYSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYDIMVKCWNSEPEKRPSFYLLSEIVENLLPGEYKK
SYERIHLDFLKSDHPAVTRMRADCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSDDELGKRNRHSSQTSEESAIETGSSSSTFVKQDDETIDDIDIIDDIGMDSSE
LVEDSFL
NT seq 2904 nt   +upstreamnt  +downstreamnt
atgggttcttctcgaaggactttcctgatcctgggatatctcctggcagggctctggcta
gcttctggacagtctttgcttcccactatttttccaaacaaagatgaaatggttgtgcag
ctgaattcccccttcaccctgaaatgctctggagacaatgaactgagttggcaacatcca
atatccgatggaaacgacacaatagatatcagaagcgaagagaacaacagcggcctgttt
gtgactttgcttgaagtaggaaaggcgtccgccactcacaccggattatatgtttgttac
tacaatcattctcaagaggaagatgtggaggtggaggggaaggagatctatgtctatgtg
ccagatccagctgtccctttcgttcctacatccccagaagaccaaatcattttcgtcact
gatgtagatgagtcgtctgtcatcccttgccgcacaagtgatcgcaatgctcaagtgact
ctcctgaacagtgaaggaaaaaccgtgtatgccttttatgaccacaaacagggcttcatt
ggaaacttctctgcgggctcctataagaacaaaggcacgatcacagtggaagacatcaaa
attccatcccagaagctggtatataccttgaacatccccaatgcttcagtagaagacact
ggaaattatgagtgtgccgcccaacatgtgatcaatgatgttacaaaaacccagaaaata
gtaatcacagtttatgataaagggttcattcgcttggagccccattttagcctcctggaa
gacgtcaatctacatggagtgaaaaacttcgtacttgatgtctatgcatacccagctccc
agaatgctctggctgaagaacaatgtgactctgattgagaatctcaccgagattgtcact
agttccaagcagattaatgaaacaaggtaccgaagtgtgttaaaactaattcgtgccaag
gaagaagacaatgggaattatactgttatagcacagaatgaagatgaaattcaaagatat
actttctctctgcttgtccaagttccagctataattcaggacctggtggatattcatcaa
ggctcagctgtgcagacagtgaaatgcttggcaaaagggacgccccttccagatgtggaa
tggctggtttgcaaggacatcaaaagatgcagcaatgaaagctcatggacacttctgact
aacaatatctcagatattactatggatgctcaccttgatgagaaaaacgcagttgagagc
caggtgacctttcagaaagtggaagagacattggccgttcgatgcatggcaaggaacgac
cttggtaccgttacacgagaactgaagcttgtggcacctactttaagatctgaactgacg
gtggccgctgcagtccttgtgttgctagtgattgcaatcatttcgttgatcgtcctggta
atcatatggaaacagaagccaagatacgaaataagatggagagttattgagtccatcagc
cccgatggccatgagtacatttatgtggatcccatgcagctaccctatgactcaagatgg
gagtttcccagggatggattagtgctgggccggatcctgggctccggagcttttgggaaa
gtagttgaaggaactgcctatggattgagccgatctcagccagtgatgaaagtggctgta
aaaatgctgaagcccacagcaagatccagtgaaaaacaggctctcatgtctgaattgaag
ataatgacccaccttgggccccacttgaacattgtgaacctgttaggagcatgtacaaaa
tcaggtccaatttatatcattacggaatactgcttttatggagatttggtgaactacctg
cataaaaacagagacaactttctgagccgaaatcctgaaaaattcaagaaagatctggac
atctttgggatgaattcagttgatgaaagtaataggagttatgtgatcctgtcttttgaa
aataatggtgaatatatggatatgaaacaagcggaaacaactcagtatgtgcccatgtta
gaaaggaaagacaggtcaaaatattccgacatccaaaggtctctgtatgaccggcctgct
tcgtataagaagaaatctgtgttggttgccatcctcctgatctgtgactttggtctggct
agagacatcatgcatgactcaaactacgtttccaaaggcagcacttttcttccagtgaaa
tggatggcacctgagagtatttttgacaacctgtatacaacactgagtgatgtctggtcg
tatggcannnnnnnnnnnnatgagtattctttaggtggcactccttatcctggcatgatg
gttgactcaacgttctataacaaaattaaaagtggctatcgaatggcaaaacctgaccat
gctactaatgaggtgtatgatatcatggtcaaatgctggaacagtgaacctgagaaaaga
ccttccttttacctcttgagtgaaatagttgaaaatctgttgcctggagaatacaagaag
agttacgagaggattcacttggactttctgaagagcgaccatcctgctgtcacgcgcatg
agagctgactgcgacaacacctacattggcgtcacttacaagaatgaagacaaactgaag
gaccgggagagtggatttgatgaacaaagactcagcgccgacagcggctacataatcccc
ctgcctgatattgaccctgtttccgatgacgagctcggcaaaagaaataggcacagttcc
cagacgtctgaagaaagtgccattgaaaccggctctagcagttctacgttcgtcaagcaa
gacgacgagaccattgacgatattgacattatcgatgacataggaatggattcttcagaa
ctggttgaggacagcttcctgtaa

DBGET integrated database retrieval system