Gekko japonicus: 107106083 Help Entry 107106083         CDS       T04299                                  Definition (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism gja  Gekko japonicus Pathway gja04144   Endocytosis gja04150   mTOR signaling pathway gja04270   Vascular smooth muscle contraction gja04310   Wnt signaling pathway gja04350   TGF-beta signaling pathway gja04510   Focal adhesion gja04520   Adherens junction gja04530   Tight junction gja04621   NOD-like receptor signaling pathway gja04625   C-type lectin receptor signaling pathway gja04810   Regulation of actin cytoskeleton gja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gja00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107106083    04350 TGF-beta signaling pathway     107106083    04150 mTOR signaling pathway     107106083  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107106083   09144 Cellular community - eukaryotes    04510 Focal adhesion     107106083    04520 Adherens junction     107106083    04530 Tight junction     107106083   09142 Cell motility    04810 Regulation of actin cytoskeleton     107106083  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107106083    04625 C-type lectin receptor signaling pathway     107106083   09153 Circulatory system    04270 Vascular smooth muscle contraction     107106083  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107106083  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gja04131]     107106083   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gja04147]     107106083    04031 GTP-binding proteins [BR:gja04031]     107106083 Membrane trafficking [BR:gja04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     107106083 Exosome [BR:gja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107106083   Exosomal proteins of other body fluids (saliva and urine)    107106083   Exosomal proteins of colorectal cancer cells    107106083   Exosomal proteins of bladder cancer cells    107106083 GTP-binding proteins [BR:gja04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     107106083 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  107106083 NCBI-ProteinID:  XP_015261655 LinkDB All DBs Position Un AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKNPCQLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatacgcaagaagcttgtcattgtgggagacggagcgtgtgggaagacctgc ctccttatcgtcttcagcaaggaccagttcccagaggtgtatgtccccaccgtcttcgag aactatgtggctgacatcgaggtggatggaaagcaggtagaacttgccctgtgggatacc gcgggccaagaggattacgaccgcctgagacccctctcttaccctgacacagatgtcatc ctcatgtgcttttccattgacagccccgacagtttagaaaatatccctgagaagtggact ccggaggtgaagcacttctgtcccaacgtgcctatcattctggtggggaacaagaaggat ctgcgtaacgacgagcacacgcgccgggagctggccaagatgaagcaggagccggtgaag ccagaggagggccgcgacatggccaacaggattagtgcttttggatacctggaatgctct gccaagacaaaggacggagtacgggaagtgttcgagatggccacccgggctgccttgcag gccaagcgtgggcgtaagaagaacccgtgccagctgctgtaa

Gekko japonicus: 107107158 Help Entry 107107158         CDS       T04299                                  Gene name RHOA Definition (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism gja  Gekko japonicus Pathway gja04144   Endocytosis gja04150   mTOR signaling pathway gja04270   Vascular smooth muscle contraction gja04310   Wnt signaling pathway gja04350   TGF-beta signaling pathway gja04510   Focal adhesion gja04520   Adherens junction gja04530   Tight junction gja04621   NOD-like receptor signaling pathway gja04625   C-type lectin receptor signaling pathway gja04810   Regulation of actin cytoskeleton gja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gja00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107107158 (RHOA)    04350 TGF-beta signaling pathway     107107158 (RHOA)    04150 mTOR signaling pathway     107107158 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107107158 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     107107158 (RHOA)    04520 Adherens junction     107107158 (RHOA)    04530 Tight junction     107107158 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     107107158 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107107158 (RHOA)    04625 C-type lectin receptor signaling pathway     107107158 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     107107158 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107107158 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gja04131]     107107158 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gja04147]     107107158 (RHOA)    04031 GTP-binding proteins [BR:gja04031]     107107158 (RHOA) Membrane trafficking [BR:gja04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     107107158 (RHOA) Exosome [BR:gja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107107158 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    107107158 (RHOA)   Exosomal proteins of colorectal cancer cells    107107158 (RHOA)   Exosomal proteins of bladder cancer cells    107107158 (RHOA) GTP-binding proteins [BR:gja04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     107107158 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  107107158 NCBI-ProteinID:  XP_015262900 LinkDB All DBs Position Un AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcggaaaaaactggttatagtgggtgatggtgcctgtggcaagacttgt cttctcattgtatttagtaaagaccagtttcctgaagtttatgtccccacagtatttgaa aactatgtagcagatattgaagttgattcgaagcaggtggagttggccttatgggataca gcaggacaagaagactatgatcgacttaggcctctttcatacccagacactgatgttata cttatgtgtttttcaattgatagccccgatagtttagagaacattccagagaagtggact ccagaggtaaagcatttttgccccaacgtacccatcatcctggtaggcaataagaaggat ttgagaaatgatgaacacacaagacgggaactggccaaaatgaagcaggaaccagtcaaa cctgaagagggcagggatatggcaaaccgcattggtgcttttggatacatggagtgcagt gcaaagaccaaagacggtgtgagggaagtttttgaaatggccactagagctgctttacaa gcccggcgtggcaagaaaaaatctgggtgccttctcttgtaa

Gekko japonicus: 107124777 Help Entry 107124777         CDS       T04299                                  Definition (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism gja  Gekko japonicus Pathway gja04144   Endocytosis gja04150   mTOR signaling pathway gja04270   Vascular smooth muscle contraction gja04310   Wnt signaling pathway gja04350   TGF-beta signaling pathway gja04510   Focal adhesion gja04520   Adherens junction gja04530   Tight junction gja04621   NOD-like receptor signaling pathway gja04625   C-type lectin receptor signaling pathway gja04810   Regulation of actin cytoskeleton gja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gja00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107124777    04350 TGF-beta signaling pathway     107124777    04150 mTOR signaling pathway     107124777  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107124777   09144 Cellular community - eukaryotes    04510 Focal adhesion     107124777    04520 Adherens junction     107124777    04530 Tight junction     107124777   09142 Cell motility    04810 Regulation of actin cytoskeleton     107124777  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107124777    04625 C-type lectin receptor signaling pathway     107124777   09153 Circulatory system    04270 Vascular smooth muscle contraction     107124777  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107124777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gja04131]     107124777   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gja04147]     107124777    04031 GTP-binding proteins [BR:gja04031]     107124777 Membrane trafficking [BR:gja04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     107124777 Exosome [BR:gja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107124777   Exosomal proteins of other body fluids (saliva and urine)    107124777   Exosomal proteins of colorectal cancer cells    107124777   Exosomal proteins of bladder cancer cells    107124777 GTP-binding proteins [BR:gja04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     107124777 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Motif Other DBs NCBI-GeneID:  107124777 NCBI-ProteinID:  XP_015283776 LinkDB All DBs Position Un AA seq 105 aa AA seqDB search MSAVRKKLLIAGDGTCGEMCLLFVFSKYQFPEVYVPSVFENYVADTEVDSKQEPVKPEEG RDVANHIGAFGHVECGAKTKDGVRGVFEMVTGAALQARRGKKKLG NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtcagccgttcggaaaaagctgcttatagcgggtgatggcacctgcggcgagatgtgt cttctctttgtatttagtaaataccagtttcctgaagtttatgtcccctcagtatttgaa aactatgtggcagatactgaagttgattctaagcaggaaccagtcaaacccgaagagggc agggatgtggcaaaccacatcggtgcttttggacacgtggagtgcggtgcaaagaccaaa gatggtgtgaggggagtttttgaaatggtcactggagctgctttacaagctcggcgtggc aagaaaaaattggggtaa

DBGET integrated database retrieval system