KEGG   Gekko japonicus: 107106083
Entry
107106083         CDS       T04299                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
gja  Gekko japonicus
Pathway
gja04144  Endocytosis
gja04150  mTOR signaling pathway
gja04270  Vascular smooth muscle contraction
gja04310  Wnt signaling pathway
gja04350  TGF-beta signaling pathway
gja04510  Focal adhesion
gja04520  Adherens junction
gja04530  Tight junction
gja04621  NOD-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107106083
   04350 TGF-beta signaling pathway
    107106083
   04150 mTOR signaling pathway
    107106083
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107106083
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107106083
   04520 Adherens junction
    107106083
   04530 Tight junction
    107106083
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107106083
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107106083
   04625 C-type lectin receptor signaling pathway
    107106083
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107106083
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107106083
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107106083
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107106083
   04031 GTP-binding proteins [BR:gja04031]
    107106083
Membrane trafficking [BR:gja04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107106083
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107106083
  Exosomal proteins of other body fluids (saliva and urine)
   107106083
  Exosomal proteins of colorectal cancer cells
   107106083
  Exosomal proteins of bladder cancer cells
   107106083
GTP-binding proteins [BR:gja04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107106083
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107106083
NCBI-ProteinID: XP_015261655
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ
AKRGRKKNPCQLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatacgcaagaagcttgtcattgtgggagacggagcgtgtgggaagacctgc
ctccttatcgtcttcagcaaggaccagttcccagaggtgtatgtccccaccgtcttcgag
aactatgtggctgacatcgaggtggatggaaagcaggtagaacttgccctgtgggatacc
gcgggccaagaggattacgaccgcctgagacccctctcttaccctgacacagatgtcatc
ctcatgtgcttttccattgacagccccgacagtttagaaaatatccctgagaagtggact
ccggaggtgaagcacttctgtcccaacgtgcctatcattctggtggggaacaagaaggat
ctgcgtaacgacgagcacacgcgccgggagctggccaagatgaagcaggagccggtgaag
ccagaggagggccgcgacatggccaacaggattagtgcttttggatacctggaatgctct
gccaagacaaaggacggagtacgggaagtgttcgagatggccacccgggctgccttgcag
gccaagcgtgggcgtaagaagaacccgtgccagctgctgtaa

KEGG   Gekko japonicus: 107107158
Entry
107107158         CDS       T04299                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
gja  Gekko japonicus
Pathway
gja04144  Endocytosis
gja04150  mTOR signaling pathway
gja04270  Vascular smooth muscle contraction
gja04310  Wnt signaling pathway
gja04350  TGF-beta signaling pathway
gja04510  Focal adhesion
gja04520  Adherens junction
gja04530  Tight junction
gja04621  NOD-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107107158 (RHOA)
   04350 TGF-beta signaling pathway
    107107158 (RHOA)
   04150 mTOR signaling pathway
    107107158 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107107158 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107107158 (RHOA)
   04520 Adherens junction
    107107158 (RHOA)
   04530 Tight junction
    107107158 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107107158 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107107158 (RHOA)
   04625 C-type lectin receptor signaling pathway
    107107158 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107107158 (RHOA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107107158 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107107158 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107107158 (RHOA)
   04031 GTP-binding proteins [BR:gja04031]
    107107158 (RHOA)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107107158 (RHOA)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107107158 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   107107158 (RHOA)
  Exosomal proteins of colorectal cancer cells
   107107158 (RHOA)
  Exosomal proteins of bladder cancer cells
   107107158 (RHOA)
GTP-binding proteins [BR:gja04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107107158 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107107158
NCBI-ProteinID: XP_015262900
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagccattcggaaaaaactggttatagtgggtgatggtgcctgtggcaagacttgt
cttctcattgtatttagtaaagaccagtttcctgaagtttatgtccccacagtatttgaa
aactatgtagcagatattgaagttgattcgaagcaggtggagttggccttatgggataca
gcaggacaagaagactatgatcgacttaggcctctttcatacccagacactgatgttata
cttatgtgtttttcaattgatagccccgatagtttagagaacattccagagaagtggact
ccagaggtaaagcatttttgccccaacgtacccatcatcctggtaggcaataagaaggat
ttgagaaatgatgaacacacaagacgggaactggccaaaatgaagcaggaaccagtcaaa
cctgaagagggcagggatatggcaaaccgcattggtgcttttggatacatggagtgcagt
gcaaagaccaaagacggtgtgagggaagtttttgaaatggccactagagctgctttacaa
gcccggcgtggcaagaaaaaatctgggtgccttctcttgtaa

KEGG   Gekko japonicus: 107124777
Entry
107124777         CDS       T04299                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
gja  Gekko japonicus
Pathway
gja04144  Endocytosis
gja04150  mTOR signaling pathway
gja04270  Vascular smooth muscle contraction
gja04310  Wnt signaling pathway
gja04350  TGF-beta signaling pathway
gja04510  Focal adhesion
gja04520  Adherens junction
gja04530  Tight junction
gja04621  NOD-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107124777
   04350 TGF-beta signaling pathway
    107124777
   04150 mTOR signaling pathway
    107124777
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107124777
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107124777
   04520 Adherens junction
    107124777
   04530 Tight junction
    107124777
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107124777
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107124777
   04625 C-type lectin receptor signaling pathway
    107124777
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107124777
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107124777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107124777
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107124777
   04031 GTP-binding proteins [BR:gja04031]
    107124777
Membrane trafficking [BR:gja04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107124777
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107124777
  Exosomal proteins of other body fluids (saliva and urine)
   107124777
  Exosomal proteins of colorectal cancer cells
   107124777
  Exosomal proteins of bladder cancer cells
   107124777
GTP-binding proteins [BR:gja04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107124777
SSDB
Motif
Pfam: Ras
Other DBs
NCBI-GeneID: 107124777
NCBI-ProteinID: XP_015283776
LinkDB
Position
Un
AA seq 105 aa
MSAVRKKLLIAGDGTCGEMCLLFVFSKYQFPEVYVPSVFENYVADTEVDSKQEPVKPEEG
RDVANHIGAFGHVECGAKTKDGVRGVFEMVTGAALQARRGKKKLG
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtcagccgttcggaaaaagctgcttatagcgggtgatggcacctgcggcgagatgtgt
cttctctttgtatttagtaaataccagtttcctgaagtttatgtcccctcagtatttgaa
aactatgtggcagatactgaagttgattctaagcaggaaccagtcaaacccgaagagggc
agggatgtggcaaaccacatcggtgcttttggacacgtggagtgcggtgcaaagaccaaa
gatggtgtgaggggagtttttgaaatggtcactggagctgctttacaagctcggcgtggc
aagaaaaaattggggtaa

DBGET integrated database retrieval system