KEGG   Gekko japonicus: 107106980Help
Entry
107106980         CDS       T04299                                 

Definition
(RefSeq) 4-trimethylaminobutyraldehyde dehydrogenase-like
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107106980
   00053 Ascorbate and aldarate metabolism
    107106980
   00620 Pyruvate metabolism
    107106980
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107106980
   00561 Glycerolipid metabolism
    107106980
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107106980
   00310 Lysine degradation
    107106980
   00330 Arginine and proline metabolism
    107106980
   00340 Histidine metabolism
    107106980
   00380 Tryptophan metabolism
    107106980
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107106980
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107106980
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     107106980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107106980
NCBI-ProteinID: XP_015262682
LinkDB All DBs
Position
Un
AA seq 518 aa AA seqDB search
MLLHSGLPLLLPGFPRLFRCASTSTATGTVQLQQPLNHRDGARVQPCDGSHSEEVYEPAT
GRVIGKCLFSGEKEVDLAVQNAQAAFKIWSQKSGMERGNALLKAARAIQEQREEIATMET
INNGKSIFEALVDVDISLQCLQYYAGLAGSLAGQHIQLPGGSFAYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMVFKPSPCTPISAVMLSEIYSQAGVPRGLFNVVQGGAATG
QFLCQHPSVAKVSFTGSVSTGIKIMAMASHGVKPVTLELGGKSPLLIFSDCILANAVKGA
LMANFLTQGEVCSNGTRVFVQRGILQAFTEEVVIQTQKIKIGDPLLNDTRMGALINQPHL
KKVLSFVTQAKEQGAEVLCGGEAYVPDDPKLSNGFYMSPCVLGNCEDNMTCVKEEIFGPV
MSILPFDTEEEALERANSTCFGLAGGVFTRDLQRAHRVAAGLQAGTCFINNYNVIPVELP
FGGYKMSGFGRENGTAAIAYYSQLKTVYVEMGNVESVF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttctccattccggcttgccgctcctgctccctggcttccctcgtctattccgctgt
gcttccacgagcactgcgactggcaccgttcaattgcagcagcctctcaaccaccgagac
ggggcccgggtccagccttgtgatgggagtcacagtgaggaagtgtatgagccagcaacc
ggccgtgttatcggcaagtgcctcttctctggggagaaggaggtggatctggctgtgcag
aatgcacaagcggcatttaagatatggagccagaaatcaggcatggaacggggcaacgca
ctcttgaaggctgccagggccatccaggaacagagggaagaaattgctaccatggaaaca
atcaataatgggaagtccatctttgaagccctggtggatgttgacatatctttgcaatgt
ctgcagtactatgctggcttagctggctctctggcaggtcagcacatccaactgcccgga
ggatccttcgcttacaccagaagagaaccgctgggtgtgtgtgttgggattggtgcctgg
aactaccctttccagatcgcctgctggaaatcagccccggccttggcttgtggtaacgcc
atggtcttcaagccttctccctgcacccccatctctgctgtgatgctgtcagagatctac
agccaggcgggtgtccccagggggcttttcaatgtggtgcaggggggggctgccacaggc
cagttcctgtgccagcacccgagtgtggccaaggtctctttcactggcagtgtgtctaca
ggaattaagattatggcgatggcatcccatggggtcaagccagttactctggagctaggg
ggcaagtcccccctcctcatcttctctgactgtatcctggcgaacgcagtgaaaggagcc
ctcatggccaatttcctcacccaaggcgaggtttgctccaatggaacacgggtgtttgta
caacgtggcatcctgcaggcctttaccgaggaagtggtgatacagacccagaaaataaaa
attggagatcctctgctgaatgacaccaggatgggggcacttatcaaccaaccccacctg
aagaaggtgctgagctttgttacacaagcaaaggagcagggtgcagaagtgctgtgcgga
ggagaggcatatgtaccagacgaccccaagctgagcaatggcttctacatgtctccctgt
gtattaggaaactgtgaagacaacatgacatgtgtaaaggaggagatctttgggcctgtc
atgtccatcctgcccttcgatacggaggaggaggccctggagagagccaacagcacctgc
ttcggcctggcggggggtgtcttcaccagggacctccagcgggctcacagggtggcggcc
ggcctccaggcggggacgtgcttcatcaacaattacaacgttattccggtcgagctgccc
ttcggagggtacaagatgtcagggtttggcagagagaatggcacagcagcgattgcttac
tactctcagctgaagactgtctatgtggagatgggcaacgtggagtcggtgttctag

KEGG   Gekko japonicus: 107111228Help
Entry
107111228         CDS       T04299                                 

Gene name
ALDH3A2
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107111228 (ALDH3A2)
   00053 Ascorbate and aldarate metabolism
    107111228 (ALDH3A2)
   00620 Pyruvate metabolism
    107111228 (ALDH3A2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107111228 (ALDH3A2)
   00561 Glycerolipid metabolism
    107111228 (ALDH3A2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107111228 (ALDH3A2)
   00310 Lysine degradation
    107111228 (ALDH3A2)
   00330 Arginine and proline metabolism
    107111228 (ALDH3A2)
   00340 Histidine metabolism
    107111228 (ALDH3A2)
   00380 Tryptophan metabolism
    107111228 (ALDH3A2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107111228 (ALDH3A2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107111228 (ALDH3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 107111228
NCBI-ProteinID: XP_015267644
LinkDB All DBs
Position
Un
AA seq 514 aa AA seqDB search
MEKIKEAVERARSAFNTGKTRPLEFRIQQLKAIERMLKEREKEITEALKADLNKSCYNSF
SYEIMVVLLELEIAVSKLPEWAAPQRVEKSIMVLMDEAYIHHEPLGVVLTIGAWNYPFAL
VMHPLVGAIAAGNAVVVKPSEVSEHTAKLLEELLPQYLDKDLYPVVTGGIPETTELLKQK
FDHIIYTGNSSVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDVDVACRRVAWGKYMNC
GQTCIAPDYVLCDPSIEGRVVEGIKKALAEYYGEDVKKSPDYERIVNKRHFKRIMGLLEG
QKVTYGGEADEASCFIAPTILTDVNPNSKVMQEEIFGPILPIVTVKNLDEAIHFINHREK
PLALYVFAKDKAIIKRMIAETSSGGVTANDVLMHFTLPSLPFGGVGHSGMGAYHGRFSFQ
TFSHQRSCLVRSLTMEGINKVRYPPGSQKKVDWAKFFILKRCNKSKVGLVVLAVLGVFLA
VAIKNRRPVLGLKRLLAALAGRRLWKLDRGCRNS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggagaagattaaggaagccgtggagcgggccaggagcgccttcaacaccggcaaaaca
cgccccttggaattcagaatccagcagctgaaggccatcgagaggatgctgaaagagcga
gagaaggagatcaccgaggccctcaaagcggatctcaacaagagctgctacaactccttc
agctatgagattatggtggtcctgctggaactcgagatagccgtgagcaagcttccggaa
tgggccgccccgcagcgggtggagaagagcatcatggtgctgatggacgaagcctacatc
caccatgagccactgggtgtggtcctgaccatcggggcctggaactacccctttgccctc
gtaatgcaccctctggtcggggccatcgcggcagggaacgctgtcgtggtcaagccctcc
gaggtcagcgaacacaccgcgaagctcctggaggagctgctcccacagtacctggacaag
gacttgtacccagttgtcaccggagggatccccgagacgaccgaactgctgaagcagaaa
ttcgaccacatcatctacacgggcaacagctccgtgggcaagatcgtcatggaagccgcc
gccaagcacctcacgcccgtcaccctcgagttgggcgggaagagcccctgctacattgac
aaagactgtgacgtcgatgtggcttgcagacgggtcgcgtgggggaagtacatgaactgc
ggccagacctgcattgctcccgactacgtcctgtgcgacccgtccatcgaaggccgagtc
gtggagggcataaaaaaggccctggcggaatattacggcgaggacgtcaagaagtccccc
gactacgaacggatagtgaacaagcggcacttcaagagaatcatggggttgctggaaggg
cagaaggtcacttacggcggggaagctgacgaagccagctgcttcatagcacccaccatc
ctcaccgacgtcaaccccaactccaaggtcatgcaggaggagatctttggccccatcctt
cccattgtcaccgtaaagaaccttgacgaggccatccacttcatcaaccaccgagagaag
ccactggctctgtacgtcttcgccaaagacaaggcgatcatcaaacggatgatcgccgag
acctccagcggtggcgtgacggccaacgacgtcctcatgcatttcacgctccccagcttg
ccgttcggcggggtcggccacagtgggatgggggcctaccacggccgcttcagcttccag
accttctcccaccagcggtcctgcctcgtccggtccctcaccatggaaggcatcaacaag
gtccgctacccgcccggcagccagaaaaaggtggactgggccaagttcttcattttgaag
cggtgcaacaaaagcaaggtcgggcttgttgtcctcgccgttctgggagtcttcttggct
gtcgccataaagaaccgccgtcctgtgctagggcttaagcgcctgctggctgccctggcc
gggcggaggctgtggaagctggataggggctgtcgcaattcctga

KEGG   Gekko japonicus: 107112148Help
Entry
107112148         CDS       T04299                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107112148 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    107112148 (ALDH2)
   00620 Pyruvate metabolism
    107112148 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107112148 (ALDH2)
   00561 Glycerolipid metabolism
    107112148 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107112148 (ALDH2)
   00310 Lysine degradation
    107112148 (ALDH2)
   00330 Arginine and proline metabolism
    107112148 (ALDH2)
   00340 Histidine metabolism
    107112148 (ALDH2)
   00380 Tryptophan metabolism
    107112148 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107112148 (ALDH2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107112148 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107112148
NCBI-ProteinID: XP_015268712
LinkDB All DBs
Position
Un
AA seq 525 aa AA seqDB search
MLQAAFQTPCKAAPLRLLLGCRPLSFAAAAAAVPQPNTRPDISYKKIFINNEWHDSTSRK
TFPTINPSTGEVICQVAEGDKADVDKAVKAARDAFKFGSPWRRMDASQRGALLYRLADLI
ERDRAYLAALETLDNGKPYAVAYLVDLDMVIKHLRYYAGWADKFHGKTVSMDGDFFTYTR
HEPVGVCGQVIPWNFPLLMQAWKLGPALATGNVVVMKLAEQTPLTGLYVASLIKEAGFPP
GVVNIIPGFGHTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPN
IIMSDADMDWAVEQAHSALFFNQGQCCCAGSRTYVQEDIYHEFVERSVERAKARVVGNPF
DLRTEQGPQVDENQYKKVLGYISTGKKEGAKLLYGGSPAADKGYFIQPTIFGEVQDSMII
AKEEIFGPVMQILRFKSIEEVINRANDTKYGLAAAVFTKDIDKANYISQGLRAGTVWINC
YNVFGSQAPFGGYKASGQGREGGEYGLQPYTEVKTVTVKVPQKNS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagcggcgttccagactccctgcaaggcggctcctctccgcctgctcctcggc
tgcagacctttgtcctttgcggccgccgccgctgccgtcccgcagcccaacacgcggccg
gacatctcctacaagaagattttcatcaacaatgaatggcacgactccaccagcaggaaa
acattcccgaccatcaacccatccacaggcgaggtcatctgccaggtcgccgaaggagac
aaggcggatgttgacaaggcggtcaaggcagccagagatgcattcaaatttggatctcct
tggagaaggatggatgcttcccaacgaggcgcactgctgtaccgtctcgctgacctgatt
gagagagaccgcgcttacctggctgctctggaaaccttggacaatggcaagccgtatgct
gttgcctacctggtggatttagacatggtcatcaaacacctccggtactatgctggttgg
gcagacaaattccatgggaaaactgtgtccatggacggagactttttcacctacacaagg
catgagccagttggggtctgtggacaggtcattccatggaatttcccactgctcatgcaa
gcctggaaactcgggccggcattggccacagggaacgtggtggtgatgaaactggctgag
caaacccctctgactgggttgtatgtggccagtctgatcaaggaggctggattcccccct
ggcgtggtgaacattattcctggctttgggcacacagcaggggctgccatttcttcccac
atggatatcgataaagtggcgttcactggctccacggaggttggtcacctaatccaaaag
gctgctgctgaaagtaatctgaagagagtgacacttgagctgggggggaagagcccaaat
atcatcatgtctgatgctgacatggactgggctgttgagcaagcccattctgccttgttc
ttcaatcagggacagtgctgctgtgctggttctcggacatacgtccaagaggatatatac
catgagtttgtggaaaggagtgtggagcgagccaaagccagggtggttgggaacccattt
gacttaaggacagaacaaggacctcaggtagatgagaatcagtataagaaggtccttgga
tacatcagtaccgggaaaaaggaaggagcaaaactgctttatggaggcagtccggctgca
gacaaaggctacttcatccagccaaccatctttggagaagtccaagacagcatgattatt
gctaaagaggagatatttgggccagtcatgcagatcctaaggttcaaatccattgaggaa
gtcatcaacagagcaaatgacaccaagtatggcttggcagcagccgtcttcaccaaagat
attgataaagcgaactacatttctcagggtttgcgtgctggaaccgtctggataaactgt
tacaacgtgtttggcagccaggctccatttggggggtacaaagcgtctggacaaggccgt
gaggggggagaatacggcttgcaaccatacacggaggtgaaaacggtaacagtaaaagtt
ccacagaagaattcctaa

KEGG   Gekko japonicus: 107112391Help
Entry
107112391         CDS       T04299                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00260  Glycine, serine and threonine metabolism
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
gja_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107112391 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    107112391 (ALDH7A1)
   00620 Pyruvate metabolism
    107112391 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107112391 (ALDH7A1)
   00561 Glycerolipid metabolism
    107112391 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107112391 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    107112391 (ALDH7A1)
   00310 Lysine degradation
    107112391 (ALDH7A1)
   00330 Arginine and proline metabolism
    107112391 (ALDH7A1)
   00340 Histidine metabolism
    107112391 (ALDH7A1)
   00380 Tryptophan metabolism
    107112391 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107112391 (ALDH7A1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107112391 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     107112391 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     107112391 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107112391
NCBI-ProteinID: XP_015268999
LinkDB All DBs
Position
Un
AA seq 542 aa AA seqDB search
MMLLKLSLAAFSRRVFLRERVLSFSFRPAAPMSTLLVSQPQYAWLKELGLKEENEGVYNG
TWGGRGEVVTTYCPANNEPIARVRQASLEDYEETVKKAKEAWKVWAEVPAPKRGEIVKQI
GDTLRQKIKVLGNLVSLEMGKILIEGVGEVQEYVDICDYAVGLSRMIGGPMLPSERPGHA
LIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMVCGNVCLWKGAPTTSLVSVAVTKIIAQV
LEANKLPGAICSLTCGGADIGKAMAKDERVDLLSFTGSTNVGKQVALMVQDRFGRSLLEL
GGNNAIIVFEDADLNLVIPSALFAAVGTTGQRCTTARRLLLHENIHDEVVGKLTKAYAQI
RIGDPWDANTLYGPLHTKQAVKMFLDAVELAKQQGGSVAYGGKVIERPGNYVEPTIVTGL
PHNASIVQTETFAPILYVLKFKTEEEAFAWNNEVRQGLSSSIFTKDLGRIFRWLGPKGSD
CGVVNVNIPTSGAEIGGAVGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIK
FQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgttgaagttgagcctcgccgcgttctcgcgacgcgttttcctgcgggagaga
gtcctgagcttttccttcagacccgctgcgcccatgtcgacgctgctggtcagtcagcct
caatatgcgtggctcaaagagctgggactgaaagaagaaaacgagggtgtttacaatggc
acctggggaggaagaggagaggttgtgacaacgtattgccctgctaacaatgagccaata
gccagagttcgtcaggccagcttggaagactatgaagaaacagtaaagaaagctaaagag
gcttggaaagtatgggcagaggttcctgcacctaaacgaggagaaattgtgaaacaaatt
ggtgatactttacgacagaaaatcaaagtcctggggaacttggtttccttagagatgggg
aaaatccttatcgaaggtgttggtgaagtccaggaatatgtggatatctgtgattatgct
gttggtttatcccgaatgatcggaggaccaatgttgccttcagaaagacctggtcatgcc
ttaatagagcaatggaatcctgtgggattggtaggaatcatcactgcctttaattttccc
gtagcagtttatggctggaacaatgcaattgcaatggtctgtggcaatgtctgcctctgg
aaaggtgctcctacaacatcccttgtgagtgtagctgttacaaaaataattgcccaggtt
ttggaagctaacaaactccctggtgcgatctgttctcttacatgtggtggtgcagatatt
ggcaaagcaatggcaaaagatgaaagagttgatctgctctccttcactggtagcactaat
gtgggcaaacaggtagcactgatggtacaagacagatttggacggagtttgttggagctt
ggtggaaacaatgctattatcgtgtttgaagatgcagaccttaatctagtcattccatca
gctctctttgcagctgtggggacaacaggccagaggtgcacaacggccaggaggctgctt
ttgcatgaaaacatccatgatgaagtagtgggaaagctcactaaggcatacgcacaaatc
cgcattggagatccttgggatgctaacaccctgtatggtcccctccatacaaagcaagca
gtgaagatgttcctggatgcagtggagctggctaagcagcaaggaggctctgtggcctat
ggtgggaaggttatagaacgtcctggaaactatgttgaaccaaccattgtgactggtctt
ccacataatgcatccattgtgcagacagaaacatttgcccctattctctatgtgctaaaa
ttcaagacagaagaagaagcctttgcttggaacaatgaagtaagacaaggtctctccagc
agcatttttacgaaggatttgggcaggatattccgatggcttggacctaagggatcagac
tgtggcgttgtaaatgtcaatattccaactagtggggctgaaattggaggagctgttggt
ggtgaaaagcacactggcggtggaagggaatctggcagtgactcatggaaacaatatatg
agacgatcaacttgtacaatcaattacagcaaagatttgcctctggctcaagggatcaag
tttcagtaa

KEGG   Gekko japonicus: 107116599Help
Entry
107116599         CDS       T04299                                 

Gene name
ALDH16A1
Definition
(RefSeq) aldehyde dehydrogenase 16 family member A1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107116599 (ALDH16A1)
   00053 Ascorbate and aldarate metabolism
    107116599 (ALDH16A1)
   00620 Pyruvate metabolism
    107116599 (ALDH16A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107116599 (ALDH16A1)
   00561 Glycerolipid metabolism
    107116599 (ALDH16A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107116599 (ALDH16A1)
   00310 Lysine degradation
    107116599 (ALDH16A1)
   00330 Arginine and proline metabolism
    107116599 (ALDH16A1)
   00340 Histidine metabolism
    107116599 (ALDH16A1)
   00380 Tryptophan metabolism
    107116599 (ALDH16A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107116599 (ALDH16A1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107116599 (ALDH16A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 LuxC DUF2114 MlrC_C FliS
Motif
Other DBs
NCBI-GeneID: 107116599
NCBI-ProteinID: XP_015274023
LinkDB All DBs
Position
Un
AA seq 856 aa AA seqDB search
MDWIRQMWAKSQKERGVAGEEEETNGPRLIKEEAWNLCKGLEGDPPNDTSVQEPPLLKAW
LESHGRSFGHFVDGKWLKPGGRETYATKNPTTGEHLATTLQGNGEDVKAAVSAATNAFQI
WGQQSAHVRARHLYNVARNIQKHQRLLSLLESLDSGKLLRDARDADLPLVVRHFYHYAGW
AQLMEVEMKDWKPLGVVAVLLPRNSPLLTLAWKVCPALAMGNTVVLKPASSTRLTALLLA
ELCAQAGLPPGVLNVVTGDQGLGEALAAHSDLDQVAFAGSVEAGRSLRCATAGTGKKLSL
QLGGKSPFIVFDSADLDSAVDGLVDAFWLNQGQAHNAGSQLLLQESIAKDFIQRLKRRMG
QLRVGDSLDKAMDLGALADEKQRDAIESLVVEARAEGAEIFQAWAALPSSGPFYPPTLIT
GVYTTSRCVREEMFGPVLISLTFRTAKEAVALGNSTPYGLAASVWTETLPLALEVARSLQ
VGTVWINGHNMLDAASAFGGCKESGYGRDGGKESLYEYVRPKWEIRPCSSAADLNCKTFA
TSQGTEAPLNPGEKRVPHSVTSDPDRNFPSVDRTYKLYYGGAQKRPDSMSSRAVLDHTGK
ILAYVADGSIKDIRNAVEAAHKAAPGWAKQTAHTRAQILYYLAENLELRRAEVASQLEAL
TSVGREDALREVDLSLQRLFHWAAYSDKYGGTVQETVLYGASLLFREPVGVVGITCPDEQ
PLLSFISLLAPAIIRGNCVVMVPSERYPLPALDFYQVLDTSDVPGGVVNIISGNQDHLSR
GLAEHQDVQAVWYFGSKEGSAAVEWASSGNLKRTWVNYGAGRRCWSDLQEGAGEEFLYQA
TQCKSVWMPMGDIFAN
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggactggattcggcagatgtgggcaaagagccaaaaagagagaggagttgcgggagaa
gaggaggagacgaacgggcctcggctcataaaggaggaggcctggaatctctgcaaaggc
ctcgaaggggaccccccgaacgacaccagcgtccaagagcccccgctcttaaaggcctgg
ctggagtctcacggccgcagctttgggcatttcgtagatggcaagtggctgaaaccgggg
ggaagggagacctacgccaccaaaaatcccaccacaggggagcacttggccaccaccctc
caggggaatggagaagatgtcaaagcagctgtcagtgctgccacaaatgcttttcaaatc
tggggtcaacagtctgcccacgttcgagcccgacacctctacaatgtggccaggaatatc
cagaaacaccaacggttactcagccttttggagagtctagacagcgggaaacttctccgc
gatgcccgggatgcggacctgcctttggttgtccggcatttctaccattatgctggttgg
gcccagctaatggaggtggagatgaaggactggaagcctcttggtgttgttgctgttctc
ctcccgcggaactcccctctgttgactctggcttggaaggtgtgtccagcactggccatg
gggaacacggtggtgctcaaaccagccagctcaacccgtctgacggctctgctcctggcc
gagctctgcgcccaggctgggctacctcctggagtcctcaacgttgtcacgggtgaccaa
gggctgggcgaggcattggctgcccattcggaccttgaccaagtggcttttgccggctct
gttgaggcgggccgcagcctgcgctgtgcaacagcagggaccggcaagaagctttctctg
caacttggagggaaatcacccttcattgtcttcgactctgctgacttggatagtgctgtt
gatgggctggtggatgccttttggctgaaccaaggccaggcccacaatgccgggtctcag
ctgctcctgcaggaatccattgccaaagatttcattcagcgcctgaagcgccggatgggc
cagctgcgtgtgggagactctctagacaaggccatggacctgggtgccttggctgacgag
aagcagcgagacgccattgagagcctggtggtggaagctcgggcagaaggtgctgagatc
ttccaagcctgggcagccctcccatcaagtggccccttctaccctccaaccttaatcact
ggtgtgtacactacctcccgttgcgtcagggaagagatgtttggacctgttctgatatcg
ctgactttccggacagccaaggaagcagtggcattgggaaacagcaccccctatggtttg
gctgccagtgtgtggacggagactcttccgctagctctggaagttgcccgcagtttgcag
gttgggacagtttggatcaacggccacaacatgctagatgctgcatctgcgtttggaggc
tgcaaagaaagtggctacggtcgagatggaggcaaagagagtctttatgagtatgtgaga
ccaaagtgggagatccgtccatgctccagcgctgcagacctcaactgcaaaacttttgct
acctcacaggggactgaggcccctttgaatcctggggagaagagagtcccacattccgta
acttcggatccagacaggaatttccccagcgtggaccgaacttacaagctgtactatggg
ggagcccagaagaggccggactccatgagttcccgagcagttctcgaccacactggcaaa
atcctggcttacgtggcagacgggagcatcaaagacatccgtaatgctgtggaagcggcc
cacaaggctgcccctggatgggcaaagcagacggctcatacccgggcgcagattttgtac
tacctggctgagaatctggagcttcgtcgagccgaagtggcgtcacaacttgaggccctg
accagtgtggggagagaagacgccctgcgggaggtggacctcagcctacagcggctgttc
cactgggcagcgtattccgacaaatacggtgggaccgtgcaggaaaccgttttgtatggt
gcctctcttctcttccgagagcctgtaggcgtcgtgggaatcacctgccctgacgaacag
cccctgctgagtttcatcagcttgttggctcccgccatcatccgtggcaactgcgtggtg
atggtccccagcgagcggtacccgctgcccgccctggatttctaccaggtacttgacacc
tcggatgtccctggcggagtggtgaacatcatctctggaaaccaggaccatctcagtcgg
ggtttagcggagcatcaagacgtacaagccgtgtggtactttggctccaaggagggttcc
gcagctgtggaatgggcctcctctgggaacctgaagaggacctgggtgaattacggagca
gggcggcgttgctggtccgacctgcaagaaggagcgggggaagagtttctctaccaagcc
acacaatgcaaaagcgtctggatgcccatgggtgatatattcgccaactga

KEGG   Gekko japonicus: 107118664Help
Entry
107118664         CDS       T04299                                 

Gene name
ALDH9A1
Definition
(RefSeq) aldehyde dehydrogenase 9 family member A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107118664 (ALDH9A1)
   00053 Ascorbate and aldarate metabolism
    107118664 (ALDH9A1)
   00620 Pyruvate metabolism
    107118664 (ALDH9A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107118664 (ALDH9A1)
   00561 Glycerolipid metabolism
    107118664 (ALDH9A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107118664 (ALDH9A1)
   00310 Lysine degradation
    107118664 (ALDH9A1)
   00330 Arginine and proline metabolism
    107118664 (ALDH9A1)
   00340 Histidine metabolism
    107118664 (ALDH9A1)
   00380 Tryptophan metabolism
    107118664 (ALDH9A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107118664 (ALDH9A1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107118664 (ALDH9A1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     107118664 (ALDH9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107118664
NCBI-ProteinID: XP_015276511
LinkDB All DBs
Position
Un
AA seq 516 aa AA seqDB search
MLPGSKSLLPGLPRLFGFAAMSSVTGTYELQEPLNYRGGTRVQPADGNHFEEVYEPATGR
VIGKFLCSGEKEVNLAVQSAQAAFKIWSQKSGMERSTILLEAARIIRERREEIAKMETIN
NGKSLLEALADIDVSWQCVQYYAGLAGSLAGQHIQLPGGSFAYTRREPLGVCVGIGAWNY
PFQIACWKSAPALACGNAMIFKPSPFTPISVVLLAEIYSEAGVPKGLFNVTQGGAATGQF
LCHHPNVAKVSFTGSVPTGIKIMEMAAKGIKPVTLELGGKSPLIIFSDCVLENAVKGALM
ANFLTQGEVCCNGTRVFVQREILSAFTKAVVQQTQNIKIGDPLLEDTRMGPLINRPHLEK
VLSFIKQAKEQGAEVLCGGEPYVPDDPKLQNGFYMSPCILGNCEDNMTCVKEEIFGPVMS
ILPFDSEEEALERANSTRFGLAGGVFTRDIQRAHRVVAGLQAGMCFINNYNISPVELPFG
GYKMSGFGRENGEAAIGYYSQLKTVCVEMGDVESVF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggttccaagtcgctgctacctggcttacctcgtctattcggttttgctgca
atgagctccgtgactggcacgtacgagttgcaggaacccctcaactaccgaggtggaacc
cgtgtccagcctgcggatgggaaccacttcgaagaagtgtatgagccagcaacaggccgt
gtcattggcaagtttctctgctctggtgagaaggaggtgaatctagctgtgcagagcgca
caggccgcatttaaaatatggagtcagaagtcaggcatggaacggagcacgatattgttg
gaggctgccaggatcatccgggaacggagggaagaaatcgctaaaatggaaaccatcaat
aatgggaagtcgctcttggaagccttggcggatattgacgtatcgtggcaatgtgtgcag
tattatgctggcttagcgggctccctggcgggtcagcacatccagctccctggaggatcc
tttgcttacaccagaagagaacctcttggggtgtgtgttggaattggggcctggaactac
cctttccagattgcctgttggaaatcagccccggcgttggcctgtggtaacgccatgatc
ttcaagccgtctcccttcacccccatctctgttgtgctgctggccgagatttacagcgaa
gccggcgtcccgaaggggcttttcaacgtgacgcaaggtggggctgccacgggccagttc
ctgtgccatcacccaaatgtggccaaagtttctttcaccggcagtgtgcccacaggcatc
aagatcatggagatggcagccaaagggatcaagccagttactctggagttgggaggcaag
tcccctctcatcatcttctcggattgcgtcctggagaatgccgtgaagggcgccctcatg
gccaatttcctcacccaaggcgaggtctgctgcaacggcacccgggtgtttgtgcaacgc
gagatcctttcggccttcaccaaggcagtcgtgcaacagacccagaacatcaaaatcgga
gaccccctgctggaagacacgcggatggggccgctcatcaaccgcccccacctggagaag
gtgctgagctttatcaagcaagcaaaggagcagggtgcggaggtgctgtgcggaggggag
ccgtatgtaccggatgaccccaagctgcaaaatggcttttacatgtctccctgcatccta
ggaaactgcgaggacaacatgacctgtgtcaaggaggagatttttgggcccgtcatgtcc
attctgccctttgattcggaggaggaggccctggagagagccaacagcacccgttttggc
ctggcggggggcgtctttaccagggacatccagcgggctcacagggtcgtggcgggtctg
caggccgggatgtgtttcatcaacaactacaacatcagccccgtggagctgccttttgga
ggctacaagatgtcagggtttggccgagagaacggcgaagcagcgatcgggtattactcc
cagctgaagactgtctgcgtggagatgggcgatgtggaatccgtgttctga

DBGET integrated database retrieval system