KEGG   Gekko japonicus: 107106980Help
Entry
107106980         CDS       T04299                                 

Definition
(RefSeq) 4-trimethylaminobutyraldehyde dehydrogenase-like
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107106980
   00053 Ascorbate and aldarate metabolism
    107106980
   00620 Pyruvate metabolism
    107106980
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107106980
   00561 Glycerolipid metabolism
    107106980
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107106980
   00310 Lysine degradation
    107106980
   00330 Arginine and proline metabolism
    107106980
   00340 Histidine metabolism
    107106980
   00380 Tryptophan metabolism
    107106980
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107106980
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107106980
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     107106980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107106980
NCBI-ProteinID: XP_015262682
LinkDB All DBs
Position
Un
AA seq 518 aa AA seqDB search
MLLHSGLPLLLPGFPRLFRCASTSTATGTVQLQQPLNHRDGARVQPCDGSHSEEVYEPAT
GRVIGKCLFSGEKEVDLAVQNAQAAFKIWSQKSGMERGNALLKAARAIQEQREEIATMET
INNGKSIFEALVDVDISLQCLQYYAGLAGSLAGQHIQLPGGSFAYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMVFKPSPCTPISAVMLSEIYSQAGVPRGLFNVVQGGAATG
QFLCQHPSVAKVSFTGSVSTGIKIMAMASHGVKPVTLELGGKSPLLIFSDCILANAVKGA
LMANFLTQGEVCSNGTRVFVQRGILQAFTEEVVIQTQKIKIGDPLLNDTRMGALINQPHL
KKVLSFVTQAKEQGAEVLCGGEAYVPDDPKLSNGFYMSPCVLGNCEDNMTCVKEEIFGPV
MSILPFDTEEEALERANSTCFGLAGGVFTRDLQRAHRVAAGLQAGTCFINNYNVIPVELP
FGGYKMSGFGRENGTAAIAYYSQLKTVYVEMGNVESVF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttctccattccggcttgccgctcctgctccctggcttccctcgtctattccgctgt
gcttccacgagcactgcgactggcaccgttcaattgcagcagcctctcaaccaccgagac
ggggcccgggtccagccttgtgatgggagtcacagtgaggaagtgtatgagccagcaacc
ggccgtgttatcggcaagtgcctcttctctggggagaaggaggtggatctggctgtgcag
aatgcacaagcggcatttaagatatggagccagaaatcaggcatggaacggggcaacgca
ctcttgaaggctgccagggccatccaggaacagagggaagaaattgctaccatggaaaca
atcaataatgggaagtccatctttgaagccctggtggatgttgacatatctttgcaatgt
ctgcagtactatgctggcttagctggctctctggcaggtcagcacatccaactgcccgga
ggatccttcgcttacaccagaagagaaccgctgggtgtgtgtgttgggattggtgcctgg
aactaccctttccagatcgcctgctggaaatcagccccggccttggcttgtggtaacgcc
atggtcttcaagccttctccctgcacccccatctctgctgtgatgctgtcagagatctac
agccaggcgggtgtccccagggggcttttcaatgtggtgcaggggggggctgccacaggc
cagttcctgtgccagcacccgagtgtggccaaggtctctttcactggcagtgtgtctaca
ggaattaagattatggcgatggcatcccatggggtcaagccagttactctggagctaggg
ggcaagtcccccctcctcatcttctctgactgtatcctggcgaacgcagtgaaaggagcc
ctcatggccaatttcctcacccaaggcgaggtttgctccaatggaacacgggtgtttgta
caacgtggcatcctgcaggcctttaccgaggaagtggtgatacagacccagaaaataaaa
attggagatcctctgctgaatgacaccaggatgggggcacttatcaaccaaccccacctg
aagaaggtgctgagctttgttacacaagcaaaggagcagggtgcagaagtgctgtgcgga
ggagaggcatatgtaccagacgaccccaagctgagcaatggcttctacatgtctccctgt
gtattaggaaactgtgaagacaacatgacatgtgtaaaggaggagatctttgggcctgtc
atgtccatcctgcccttcgatacggaggaggaggccctggagagagccaacagcacctgc
ttcggcctggcggggggtgtcttcaccagggacctccagcgggctcacagggtggcggcc
ggcctccaggcggggacgtgcttcatcaacaattacaacgttattccggtcgagctgccc
ttcggagggtacaagatgtcagggtttggcagagagaatggcacagcagcgattgcttac
tactctcagctgaagactgtctatgtggagatgggcaacgtggagtcggtgttctag

KEGG   Gekko japonicus: 107118664Help
Entry
107118664         CDS       T04299                                 

Gene name
ALDH9A1
Definition
(RefSeq) aldehyde dehydrogenase 9 family member A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00010  Glycolysis / Gluconeogenesis
gja00053  Ascorbate and aldarate metabolism
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00330  Arginine and proline metabolism
gja00340  Histidine metabolism
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00561  Glycerolipid metabolism
gja00620  Pyruvate metabolism
gja01100  Metabolic pathways
Module
gja_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107118664 (ALDH9A1)
   00053 Ascorbate and aldarate metabolism
    107118664 (ALDH9A1)
   00620 Pyruvate metabolism
    107118664 (ALDH9A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107118664 (ALDH9A1)
   00561 Glycerolipid metabolism
    107118664 (ALDH9A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107118664 (ALDH9A1)
   00310 Lysine degradation
    107118664 (ALDH9A1)
   00330 Arginine and proline metabolism
    107118664 (ALDH9A1)
   00340 Histidine metabolism
    107118664 (ALDH9A1)
   00380 Tryptophan metabolism
    107118664 (ALDH9A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107118664 (ALDH9A1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107118664 (ALDH9A1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     107118664 (ALDH9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107118664
NCBI-ProteinID: XP_015276511
LinkDB All DBs
Position
Un
AA seq 516 aa AA seqDB search
MLPGSKSLLPGLPRLFGFAAMSSVTGTYELQEPLNYRGGTRVQPADGNHFEEVYEPATGR
VIGKFLCSGEKEVNLAVQSAQAAFKIWSQKSGMERSTILLEAARIIRERREEIAKMETIN
NGKSLLEALADIDVSWQCVQYYAGLAGSLAGQHIQLPGGSFAYTRREPLGVCVGIGAWNY
PFQIACWKSAPALACGNAMIFKPSPFTPISVVLLAEIYSEAGVPKGLFNVTQGGAATGQF
LCHHPNVAKVSFTGSVPTGIKIMEMAAKGIKPVTLELGGKSPLIIFSDCVLENAVKGALM
ANFLTQGEVCCNGTRVFVQREILSAFTKAVVQQTQNIKIGDPLLEDTRMGPLINRPHLEK
VLSFIKQAKEQGAEVLCGGEPYVPDDPKLQNGFYMSPCILGNCEDNMTCVKEEIFGPVMS
ILPFDSEEEALERANSTRFGLAGGVFTRDIQRAHRVVAGLQAGMCFINNYNISPVELPFG
GYKMSGFGRENGEAAIGYYSQLKTVCVEMGDVESVF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggttccaagtcgctgctacctggcttacctcgtctattcggttttgctgca
atgagctccgtgactggcacgtacgagttgcaggaacccctcaactaccgaggtggaacc
cgtgtccagcctgcggatgggaaccacttcgaagaagtgtatgagccagcaacaggccgt
gtcattggcaagtttctctgctctggtgagaaggaggtgaatctagctgtgcagagcgca
caggccgcatttaaaatatggagtcagaagtcaggcatggaacggagcacgatattgttg
gaggctgccaggatcatccgggaacggagggaagaaatcgctaaaatggaaaccatcaat
aatgggaagtcgctcttggaagccttggcggatattgacgtatcgtggcaatgtgtgcag
tattatgctggcttagcgggctccctggcgggtcagcacatccagctccctggaggatcc
tttgcttacaccagaagagaacctcttggggtgtgtgttggaattggggcctggaactac
cctttccagattgcctgttggaaatcagccccggcgttggcctgtggtaacgccatgatc
ttcaagccgtctcccttcacccccatctctgttgtgctgctggccgagatttacagcgaa
gccggcgtcccgaaggggcttttcaacgtgacgcaaggtggggctgccacgggccagttc
ctgtgccatcacccaaatgtggccaaagtttctttcaccggcagtgtgcccacaggcatc
aagatcatggagatggcagccaaagggatcaagccagttactctggagttgggaggcaag
tcccctctcatcatcttctcggattgcgtcctggagaatgccgtgaagggcgccctcatg
gccaatttcctcacccaaggcgaggtctgctgcaacggcacccgggtgtttgtgcaacgc
gagatcctttcggccttcaccaaggcagtcgtgcaacagacccagaacatcaaaatcgga
gaccccctgctggaagacacgcggatggggccgctcatcaaccgcccccacctggagaag
gtgctgagctttatcaagcaagcaaaggagcagggtgcggaggtgctgtgcggaggggag
ccgtatgtaccggatgaccccaagctgcaaaatggcttttacatgtctccctgcatccta
ggaaactgcgaggacaacatgacctgtgtcaaggaggagatttttgggcccgtcatgtcc
attctgccctttgattcggaggaggaggccctggagagagccaacagcacccgttttggc
ctggcggggggcgtctttaccagggacatccagcgggctcacagggtcgtggcgggtctg
caggccgggatgtgtttcatcaacaactacaacatcagccccgtggagctgccttttgga
ggctacaagatgtcagggtttggccgagagaacggcgaagcagcgatcgggtattactcc
cagctgaagactgtctgcgtggagatgggcgatgtggaatccgtgttctga

DBGET integrated database retrieval system