KEGG   Gekko japonicus: 107106993Help
Entry
107106993         CDS       T04299                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gja  Gekko japonicus
Pathway
gja00062  Fatty acid elongation
gja00071  Fatty acid degradation
gja00280  Valine, leucine and isoleucine degradation
gja00310  Lysine degradation
gja00380  Tryptophan metabolism
gja00410  beta-Alanine metabolism
gja00640  Propanoate metabolism
gja00650  Butanoate metabolism
gja01100  Metabolic pathways
gja01200  Carbon metabolism
gja01212  Fatty acid metabolism
Module
gja_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gja_M00085  Fatty acid elongation in mitochondria
gja_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107106993 (ECHS1)
   00650 Butanoate metabolism
    107106993 (ECHS1)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    107106993 (ECHS1)
   00071 Fatty acid degradation
    107106993 (ECHS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107106993 (ECHS1)
   00310 Lysine degradation
    107106993 (ECHS1)
   00380 Tryptophan metabolism
    107106993 (ECHS1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107106993 (ECHS1)
Enzymes [BR:gja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107106993 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 107106993
NCBI-ProteinID: XP_015262697
LinkDB All DBs
Position
Un
AA seq 365 aa AA seqDB search
MGLCFPAFSFLGLSDGAVSQEPFRRSSATQAALNHEERELVTVSINENLKIKAGGFACEN
FPSCLHGETVKFNLHWPLGLPVSQGGGRQRCKRQLEATDCFSGAGVQFQHIVVEKKGAKE
NVGVIQLNRPKALNALCDALVKEINQALDSFEQDAHVGAIVITGSEKAFAAGADIKEMQD
RTFQECYSGNFLAHWNRVSTTKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEI
LLGTIPGAGGTQRLTRAVGKSLAMEMILTGERISAQEAKQAGLVSKVCPVDKLLDEAISC
AEKIAGNSKLVAAMAKEAVNAAFETTLAEGNKREKILFHATFATEDRKEGMSAFVEKRKA
SFTDH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggtctctgcttcccagccttctctttccttggcctgagcgacggcgccgtgtcccag
gagcctttccgcaggagcagcgccactcaggccgccttgaaccacgaggaaagggagctt
gttactgtttcaataaatgaaaatttaaaaatcaaggccggcggcttcgcttgtgaaaat
ttcccttcctgtttgcacggtgaaacggtgaagttcaaccttcactggccattggggctc
cccgtctcccaagggggtgggaggcagcgttgcaaaagacagctggaagcaaccgattgt
ttctccggagcaggtgtccagttccagcacatcgtggtggaaaagaagggagccaaggag
aacgtgggcgtgatccagctaaaccgtcccaaggccctgaacgccctttgcgacgccctc
gtgaaggaaatcaaccaggccctggactccttcgagcaggacgctcacgtgggggccatc
gtcatcaccggcagtgagaaggcctttgcagcgggagcagatatcaaagagatgcaagac
aggaccttccaggagtgctacagtgggaacttcctggctcactggaacagagtctccacc
accaagaagccggtcatagctgccgttaacggatacgcgcttggcggtggctgtgagctg
gccatgatgtgcgacatcatttacgcgggagaaaaagcacagtttgggcaacccgaaatc
ctcctgggaactattccaggcgctggcgggacccagaggctgaccagggcagtgggcaag
tcgttggccatggagatgatcctgaccggggagcggatctccgcccaagaggccaagcag
gcaggccttgtcagtaaagtctgtcccgtggataagctgctggacgaagccatcagctgt
gcggaaaagatagcggggaactccaagctggtggctgcgatggccaaagaagccgtgaat
gcagccttcgagacaaccctggccgaggggaataagcgggagaagatcctcttccatgcc
accttcgccacggaggaccggaaggaggggatgagcgccttcgtggagaagaggaaggcc
agcttcacagaccactga

DBGET integrated database retrieval system