KEGG   Gekko japonicus: 107107047Help
Entry
107107047         CDS       T04299                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gja  Gekko japonicus
Pathway
gja00250  Alanine, aspartate and glutamate metabolism
gja00410  beta-Alanine metabolism
gja00430  Taurine and hypotaurine metabolism
gja00650  Butanoate metabolism
gja01100  Metabolic pathways
Module
gja_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107107047 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107107047 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107107047 (GAD1)
   00430 Taurine and hypotaurine metabolism
    107107047 (GAD1)
Enzymes [BR:gja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107107047 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 107107047
NCBI-ProteinID: XP_015262750
LinkDB All DBs
Position
Un
AA seq 590 aa AA seqDB search
MATSEPSSSNTAQDPNTANLRPTTYDTWCGVAHGCTKKIGLKICGFLQRNNSLEDKSRLV
SALKERQSSKNLLACENSEKEVRFRRTETDFSNLYARDLLPAKNGEEQTVQFLLEVVDIL
LAYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLILFTSEHSHYSMKKAGSALGFG
TENVILVKCNERGKIIPSDLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADVCE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILLREKGIL
QGCNQMCAGYLFQQDKQYDITYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFESQINKCL
ELSEYLYNKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDCHERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVVSNPAATKSDIDFLVEEIERLGQDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctcggaaccctcctcctccaacaccgcgcaggatcccaacacggctaattta
cgacccacaacctatgacacctggtgtggagtggctcacggctgcacgaagaaaatcgga
ctcaaaatatgtgggttcttgcaaaggaataacagcctggaagacaaaagtcgcctggtg
agcgcgctcaaggaaaggcagtcgtccaagaacctgctggcctgcgagaacagcgagaag
gaagtcaggttccggaggaccgagacagatttctccaacctctatgcccgggacttgctg
ccggccaagaatggagaggagcagacggtgcagttcctactggaggtggtggacattctc
ctggcctatgtgcggaagacctttgataggtccaccaaggtgctggatttccaccaccca
caccagctcctggaaggcatggaaggattcaacctggagctctctgacaacccagagtca
cttgaacagatcctagtagactgccgggacacattgaaatacggagtcaggacaggtcat
cctcgctttttcaaccagctttctacaggactagatatcattggcttggctggggaatgg
ttgacatctactgctaataccaacatgtttacatatgaaattgcacctgtttttgtcctc
atggaacaaataacactccgaaaaatgagagagattattggatggtcaaataaagatgga
gacggtatcttctcccctggtggtgctatatccaacatgtatagcatcatggctgcccgc
tacaagtatttcccagaagtcaaaaccaaaggcatggctgcagtgccgaaactgatcctt
tttacctcagaacacagtcactattccatgaaaaaggctggatctgcacttggctttgga
actgaaaatgtgattttggtaaagtgtaatgaaaggggcaaaataataccaagcgatttg
gaagccaaaattctcgaagccaaacaaaagggatacgttcccctttatgtgaatgcaacc
gctgggacaacagtttacggggcctttgatcccattcaagagattgcagatgtttgtgaa
aaatataacctttggctgcacgtagatgctgcctggggaggtgggttgctcatgtccaga
aagcatcgtcataagctgaatggaatagaaagagccaattctgtcacgtggaatccacac
aagatgatgggagttttattacagtgttctgccattcttcttcgggaaaagggtatactt
caaggttgcaaccagatgtgtgcaggatatctgtttcagcaagacaagcaatatgatata
acctatgacactggggataaagcaatacagtgtggccgccatgtggacatattcaaattc
tggttgatgtggaaagccaagggtacagtaggatttgaaagtcagatcaacaaatgtctt
gaattatcagaatacctctacaataaaattaaaaacagagaggagtttgagatggttttc
gaaggagagcctgaacatacaaacgtatgcttctggtacattccaccaagtctcaggggt
atgccagactgtcatgagaggagagagaagttacatagggtggcaccgaaaatcaaagcc
ctaatgatggaatccggtaccacaatggttggatatcagcctcagggagataaagtcaat
ttcttccgaatggttgtttcaaatccagcagctaccaagtctgatattgacttcctcgtt
gaggagattgaaagattgggacaagatctgtaa

DBGET integrated database retrieval system