KEGG   Gekko japonicus: 107107366
Entry
107107366         CDS       T04299                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04370  VEGF signaling pathway
gja04371  Apelin signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107107366 (AKT2)
   04012 ErbB signaling pathway
    107107366 (AKT2)
   04370 VEGF signaling pathway
    107107366 (AKT2)
   04371 Apelin signaling pathway
    107107366 (AKT2)
   04068 FoxO signaling pathway
    107107366 (AKT2)
   04150 mTOR signaling pathway
    107107366 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107107366 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    107107366 (AKT2)
   04218 Cellular senescence
    107107366 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107107366 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107107366 (AKT2)
   04625 C-type lectin receptor signaling pathway
    107107366 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107107366 (AKT2)
   04920 Adipocytokine signaling pathway
    107107366 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    107107366 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107107366 (AKT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107107366 (AKT2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107107366 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107107366 (AKT2)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107107366 (AKT2)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107107366 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107107366
NCBI-ProteinID: XP_015263144
LinkDB
Position
Un
AA seq 458 aa
MNEVSVIKEGWLHKRGEYIKTWRPRXXXXXSAGSFIGYKEKPETSEHSLPPLNDFSVAEC
QLMKAERPRPNTFIIRCLQWTTVIERTFHVDSPDEREEWIRAIQMVANSLKNQEPEEDRM
DYQGGSPGGSTGAEEMEVVAVTQARAKATMNDFDYLKLLGKGTFGKVILVREKATGRYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTNDRLCFVMEYANGGELFF
HLSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPRTLSPEAKALLAGLLKKDPKQRLGGGPNDAKEVMEHRFFAAVNWQDVVQ
RKLIPPFKPQVTSEIDTRYFDDEFTAQSITITPPDRCE
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtccgtcatcaaggaggggtggctgcacaagagaggtgaatacatcaaa
acgtggcggcccaggnnnnnnnnnnnnnnnagcgccgggtccttcattgggtacaaggag
aaacctgagacgtctgagcacagcttgccccctttgaatgacttctctgtggcagaatgc
cagctcatgaaagcggagcgcccccggcccaacaccttcatcatccgctgcctgcagtgg
acgaccgtcatcgagaggaccttccacgtcgactcccccgacgaacgggaggagtggatc
cgggccatccagatggttgccaacagcctgaagaaccaggagccggaagaggaccggatg
gactaccagggcggctctcctgggggcagcactggggcggaggagatggaggtggtggct
gtgacccaggcccgggccaaggcgacgatgaacgactttgactacctgaagctcctgggc
aagggcactttcgggaaggtcatcctggtgcgcgagaaggccaccgggcgctactacgcc
atgaagatcctgcgcaaagaagtcatcatcgccaaggacgaggtggcccacaccgtcaca
gagagccgagtcctgcagaacaccaggcatcctttcctcacggcactgaaatacgcattc
cagaccaacgaccgcctctgctttgtcatggagtacgccaacggaggggagctcttcttc
cacctttccagagagcgggtcttcaccgaggaccgagcccgtttctacggggccgagatc
gtttctgccttggagtacctccactcccgggacgtcgtttatcgggacatcaagctggag
aatctcatgctggacaaagacggacacatcaaaatcacggactttgggttgtgcaaagag
ggcatcaccgacggggccaccatgaagaccttctgtgggacgccggagtacctggcccca
gaggtgctggaagacaacgattacgggcgggccgtggattggtggggcctgggtgtggtc
atgtacgaaatgatgtgtgggcgcctccccttctacaaccaagaccacgagcgcctcttt
gagctcatcctcatggaggaaatccgcttcccgcgcacgttgagtccggaggccaaggcc
ctcctggccggactcctcaagaaagaccccaagcagaggctcggcggaggccccaacgac
gccaaggaagtgatggagcaccggttctttgcagccgtcaactggcaagacgtggttcag
agaaagctcatcccccccttcaagccccaggtgacctccgaaatcgacacccggtacttt
gacgacgaattcacggctcagtcgatcaccatcaccccacctgaccgatgtgagtag

KEGG   Gekko japonicus: 107108180
Entry
107108180         CDS       T04299                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04370  VEGF signaling pathway
gja04371  Apelin signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107108180 (AKT1)
   04012 ErbB signaling pathway
    107108180 (AKT1)
   04370 VEGF signaling pathway
    107108180 (AKT1)
   04371 Apelin signaling pathway
    107108180 (AKT1)
   04068 FoxO signaling pathway
    107108180 (AKT1)
   04150 mTOR signaling pathway
    107108180 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107108180 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    107108180 (AKT1)
   04218 Cellular senescence
    107108180 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107108180 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107108180 (AKT1)
   04625 C-type lectin receptor signaling pathway
    107108180 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107108180 (AKT1)
   04920 Adipocytokine signaling pathway
    107108180 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    107108180 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107108180 (AKT1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107108180 (AKT1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107108180 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107108180 (AKT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107108180 (AKT1)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107108180 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107108180
NCBI-ProteinID: XP_015264070
LinkDB
Position
Un
AA seq 480 aa
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLKKQEEEIMDF
RSGSPSDNSGAEEMEISMTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQNKFFAGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCIDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagtcgccatcgtgaaggaaggctggctccacaaacgaggagagtacattaaa
acatggaggccgaggtattttctgttgaagaacgatgggacgtttattggctacaaagag
cggccgcaagacgtggaccaacgggagtccccgttaaataacttctccgtggctcagtgc
cagttgatgaagacggagcgacccaaaccgaacacattcatcatcagatgcctccagtgg
accacagtaattgaaagaacgtttcatgtggagactccagaggagcgggaagaatggaca
aaagccatccaaacagtagcagacagcctaaagaagcaggaggaagaaataatggatttt
cgatctggttcccccagtgataattcaggtgctgaagaaatggaaatttctatgacaaaa
ccaaaacataaagtgactatgaatgaattcgaatatcttaagctgctggggaaaggcacc
ttcgggaaggttattctggtgaaagagaaagcgacgggacggtattacgctatgaaaatc
ctgaagaaggaagtaattgtagcaaaggatgaagtggcacataccctgacagaaaaccgg
gttttacagaactctaggcatcctttcttaacagccttaaagtattcctttcagacgcat
gaccggctgtgcttcgtcatggagtacgccaacggaggggagctgttcttccacctatcg
cgggagcgcgtcttttctgaagaccgggcccgcttttacggagccgagattgtatcggcg
ctggactacctacattcagaaaagaacgtggtctatagggacttaaagttggaaaacttg
atgctggacaaagacgggcacataaagataacggatttcgggttgtgcaaagaagggatc
aaggacggagcgacgatgaagactttctgcggcacgccggagtatcttgcaccggaggtg
ctggaggacaatgactacgggcgcgcggtggactggtggggcttaggagtcgtcatgtac
gaaatgatgtgcgggcggctccctttctacaaccaggaccacgagaagctctttgaactc
attctcatggaagagattaggtttccgcgcacgttgtcgcccgaagcgaaatctcttctg
tccggcttgctaaagaaggatcctaagcaaaggttaggtggtgggccggatgacgccaag
gagattatgcaaaacaaattttttgccggcatcgtatggcaagatgtatatgagaaaaag
ctggtacctccatttaagccacaggtgacgtctgaaacggacacacgctactttgacgaa
gaattcacagcacagatgattacaatcacccccccagaccaagacgacagcatggattgc
atcgacagcgagcgacgacctcatttccctcaattctcgtattccgccagtgggacggct
taa

KEGG   Gekko japonicus: 107121519
Entry
107121519         CDS       T04299                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04261  Adrenergic signaling in cardiomyocytes
gja04370  VEGF signaling pathway
gja04371  Apelin signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107121519
   04012 ErbB signaling pathway
    107121519
   04370 VEGF signaling pathway
    107121519
   04371 Apelin signaling pathway
    107121519
   04068 FoxO signaling pathway
    107121519
   04150 mTOR signaling pathway
    107121519
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107121519
  09143 Cell growth and death
   04210 Apoptosis
    107121519
   04218 Cellular senescence
    107121519
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107121519
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107121519
   04625 C-type lectin receptor signaling pathway
    107121519
  09152 Endocrine system
   04910 Insulin signaling pathway
    107121519
   04920 Adipocytokine signaling pathway
    107121519
   04914 Progesterone-mediated oocyte maturation
    107121519
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107121519
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107121519
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107121519
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107121519
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107121519
Protein kinases [BR:gja01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107121519
SSDB
Motif
Pfam: Pkinase PH PK_Tyr_Ser-Thr FTA2 PH_11 DUF1892
Other DBs
NCBI-GeneID: 107121519
NCBI-ProteinID: XP_015279918
LinkDB
Position
Un
AA seq 278 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKVTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYPFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKVKKK
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagcgatgttacaattgtgaaagaaggctgggttcagaaaaggggggaatatattaaa
aattggaggccaagatacttcctcttgaagacagatggctctttcataggatataaggag
aagccccaagatgtggatctaccatatcctcttaacaacttttcagtagcaaaatgccag
ctaatgaaaacagagagaccaaaaccaaatacatttattatccgatgtcttcagtggacc
actgtgatagaaaggacttttcatgtagatacaccagaagaacgggaagaatggacagaa
gccattcaagcagtagcagacaggcttcaaaggcaggaagaggagagaatgaattgtagt
ccaacatcgcaaattgataatataggagaagaggagatggatgcatccacaactcaccat
aaaagaaaggtgacaatgaatgattttgattacttaaaactccttggcaaaggcactttt
ggcaaagttattctggttcgagagaaagcaagtggaaaatactatgctatgaagattctg
aaaaaagaagttattattgcaaaggatgaagtggcccacacacttacagaaagcagggta
ctgaaaaatactagacacccttttttaacgtctttgaaatatcccttccagaccaaggac
cgtttgtgttttgtaatggagtatgttaatggaggagagctgtttttccatttgtcgaga
gagcgggtgttctctgaggatcgcacacgcttctatggtgcagaaattgtttctgctctg
gactatctgcattctggaaagattgtgtatcgtgatctcaaggtaaaaaaaaagtaa

DBGET integrated database retrieval system