KEGG   Gekko japonicus: 107107376
Entry
107107376         CDS       T04299                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
gja  Gekko japonicus
Pathway
gja00562  Inositol phosphate metabolism
gja01100  Metabolic pathways
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107107376 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107107376 (PIK3CD)
   04370 VEGF signaling pathway
    107107376 (PIK3CD)
   04068 FoxO signaling pathway
    107107376 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    107107376 (PIK3CD)
   04150 mTOR signaling pathway
    107107376 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107107376 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    107107376 (PIK3CD)
   04218 Cellular senescence
    107107376 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107107376 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107107376 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107107376 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    107107376 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107107376 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    107107376 (PIK3CD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107107376 (PIK3CD)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107107376 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107107376 (PIK3CD)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107107376 (PIK3CD)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107107376 (PIK3CD)
SSDB
Motif
Pfam: PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd PI3_PI4_kinase
Other DBs
NCBI-GeneID: 107107376
NCBI-ProteinID: XP_015263156
LinkDB
Position
Un
AA seq 956 aa
MPPGIYCPLEFWSQEANRSIDVDFLLPTGIYLRLPVSCNASLGVIKQVVWHHAQYEPLFQ
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVHPFLPVLRLVAREGDRAKKLINSQISLL
IGKGLHEFDSLCDPEVNSFRARMQQFCEERAARRQQLTWKAWMEYCFPVQLEPVANGLRT
SPHRGPNKNIFINVRFESGGESFTFQISLQEFPVTLISYAIKKQATVFRHQRVESPEDYT
LQVNGKCEYLYGHYPLYQFQYICECLHRGLLPHLTVVHSSSILALREEQTNGIIHPPKAA
PKPPPVPKKKPTSTSLWLLEQPYSIDLVRGCKVNADERMKLVVQAGLYHGNEMLCKMVSS
SEVNVCSEPTWGQRLEFEINVCDLPRMARLCLALYAVVEKAKKARSTKKKSKKADCPIAW
VNVMLFDYRDQLKTGECFLPMWSSFPDEKDELLNPMGTVQTNPNTESAAALVIRFPTVAF
SPVYYPCLEQVLEEGRKVPCPRCMVEDQEEKQQLKEILERRSHTELYEHEKDLVWKMRYQ
IRDQYPGALSKLLLVTKWNKHEDVAQMIYLLQTWPELPVLNALELLDFSFPDRYVGTFTV
NSLKKLTDDELFQYLLQLVQVLKYESYLECELAKFLLGRALSNRKIGHFLFWHLRSEMHV
PSVALRFGLILEAYCRGSTHHMKALMKQGEALHKMRALNDIIKTSAQKNPKPQTKEFMHT
CLRQETYLEALSNLQCPLNPSTLLAKVSVDLCTFMDSKMKPLWIVFNNEEIGGTNVGIIF
KNGDDLRQDMLTLQMIHLMDILWKKEGLDLRMTPYGCLSTGDKTGLIEVIMHSDTIANIQ
LNKSNMAATAAFNKDALLNWLKSKNPGFRGYCERAYMILRCHGLLFLHLFALMKAAGLPE
LSCSKDIQYLKDSLALGKADEEARKHFHLKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgccccctggcatttactgcccccttgagttttggtcccaagaagccaaccggagcatc
gacgtcgacttcctcctgcccacaggcatctacctgaggctccccgtctcctgcaatgcg
agcctgggcgttatcaagcaggtcgtctggcaccatgcccagtacgagcccctcttccag
atgctcagcggcccggaggcctacgtcttcacctgcatcaaccagacggccgagcagcag
gagctggaagacgagcaacgccgcctctgcgacgtccaccccttcttgccggtcttgcgg
ctcgtggctcgcgaaggggaccgggccaagaagctcatcaactcgcagatcagcctgctg
atcggcaaaggtttgcacgaattcgactccctgtgtgaccctgaagtgaacagtttccgt
gcccgaatgcaacagttctgtgaagagagagcagcccggcggcagcagctgacttggaag
gcttggatggagtattgcttcccggtgcaactggaacccgtggccaacggcctccggacc
agcccccaccggggtcccaacaagaacattttcatcaacgtccgattcgaatctggaggg
gagagcttcacttttcagatctccctgcaggagttccccgtgacgctcatcagctacgcg
atcaagaagcaagccactgtcttccgccaccaaagggtggaaagccccgaggattacacc
ctgcaggtgaacgggaaatgcgaatacctctatgggcactaccccttgtatcagttccag
tacatctgcgagtgcctgcaccgtgggctgctgccccacctcaccgtggtacactcgtct
tccatcctggcgctgcgggaggagcaaaccaacggaatcattcacccccccaaagcggcc
cccaagccacctccggtccccaagaaaaagccgacttctacctccctgtggttgctggaa
cagccctactcgattgatttggtgcgaggctgcaaggtgaacgcggatgagcggatgaag
ctggtggtccaggccggcctctaccacggcaacgagatgctctgcaaaatggtgtccagc
tccgaggtcaacgtttgctcggaaccgacgtggggtcagaggctggagttcgagatcaac
gtctgcgaccttccccgcatggcgcggctctgcctggccctctacgccgtggtcgagaag
gccaagaaggccaggtccaccaagaagaagtccaagaaagccgactgcccaattgcctgg
gtgaacgtcatgctgtttgactaccgagaccagttgaaaactggggagtgtttcctcccg
atgtggtcttcctttccagatgagaaagacgagctgttgaacccgatgggcaccgtccag
accaaccccaacacggagagcgccgccgccctggtcatccgtttccccaccgtggcgttc
tctccagtgtactacccgtgcctcgaacaggtgctggaggaggggagaaaagttccgtgt
ccccgttgcatggtggaggaccaagaggagaagcaacagctgaaggagatcttggagcgc
aggtcccacacggaactttatgagcacgagaaggacctggtgtggaagatgaggtaccag
atccgggaccagtacccaggggccttgtccaagctgctgctggtgaccaagtggaacaag
cacgaagatgtcgctcagatgatctacttgctccaaacctggccggagctgcccgtcctc
aatgccctggagctgttggatttcagcttccccgaccgctacgtgggcaccttcactgtc
aactccctgaaaaaactgacggatgacgagttgttccagtacctgctgcagctggtccag
gtgttgaagtacgagtcttatttggagtgcgaattagccaagttcctgctgggcagagcc
ttgtccaatcgcaaaataggacactttctcttctggcatctcagatcagaaatgcacgtc
ccttccgtcgccttgaggtttggcctgatcctggaggcttactgccggggcagcacccac
cacatgaaggccctgatgaagcagggcgaagctctccacaagatgagggccttgaacgac
atcatcaagacgagtgctcagaagaaccccaagccccagaccaaagagttcatgcacacc
tgtctgcggcaagagacgtacctggaggccctttccaacctccagtgccccctgaatccc
agcaccctcctagcaaaagtcagtgtggacctttgcactttcatggattccaagatgaag
cccttgtggatcgtctttaacaacgaagaaatagggggcaccaacgtgggaatcattttc
aaaaacggagacgatcttcgccaggacatgttgaccctgcagatgattcacctgatggac
attttgtggaagaaagagggccttgacttgaggatgaccccttatggctgcctctccacg
ggagacaagacggggctgatcgaagtgatcatgcactcagacacgatcgccaacatccag
ctcaacaagagcaacatggctgccactgcagccttcaacaaggacgccttgctgaactgg
ctgaaatccaagaatcccggtttccgaggttactgtgagcgagcgtacatgatcctccgc
tgccacggcctcctcttcctgcacctctttgcgctgatgaaggcggccggcctgcccgaa
ctcagctgctccaaagacattcagtacctcaaggactcgctggctttagggaaagcggac
gaagaggcccggaagcatttccacctcaagttcaatgaggccttgcgggagagctggaag
accaaggtcaactggctggcgcacaacgtctccaaggacaacaggcagtag

KEGG   Gekko japonicus: 107108905
Entry
107108905         CDS       T04299                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
gja  Gekko japonicus
Pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107108905 (PIK3R1)
   04370 VEGF signaling pathway
    107108905 (PIK3R1)
   04068 FoxO signaling pathway
    107108905 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    107108905 (PIK3R1)
   04150 mTOR signaling pathway
    107108905 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107108905 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    107108905 (PIK3R1)
   04218 Cellular senescence
    107108905 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107108905 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107108905 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107108905 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    107108905 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107108905 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    107108905 (PIK3R1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107108905 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107108905 (PIK3R1)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107108905 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 DUF4201 SH3_9 Nucleopor_Nup85 SH3_2 Lant_dehydr_C PI_PP_I Laminin_I V_ATPase_I
Other DBs
NCBI-GeneID: 107108905
NCBI-ProteinID: XP_015264934
LinkDB
Position
Un
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGTLVALGFSEGEEAKPEEIGWLNGFN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPVRPLPVAPSPAKVGTDNDQPAFTLPDLSE
QFSPPDNAPPFLVKLVEAIERKGLECSTLYRTQGSSSIAELRQITECDLSTVDFDAIDLQ
ILSDALKRYFLDLPNPVIPASVYNEMIPTAQEGQNSEESAQVLKKLIRSPNIPQQYWLTL
QYLLKHFSRLCQTSTKNLLNARSLAEIFSTLLFRSQVASSDSFEHHIKILELLITSEWNE
RQPAPALPPKPPKPNTVINNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDSIEAVGKKLHEYNIQFQEKNREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSMVEDDEDLPHQDERTWNVGNINRSQAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTPTGYGFAEPYNLYNSLRELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgcagaaggataccagtacagagctttatatgattacaaaaaagaacgagaagaa
gacattgacttgcatttgggagatattttaactgtgaataaaggtactttagttgccctt
ggattcagtgaaggggaagaagcaaaacctgaagaaattggttggttgaatggctttaat
gaaactactggagaaagaggggacttcccaggaacttatgtagaatatattggaagaaaa
aagatttctcccccaactccaaagcctcgccctgttcgacctcttcctgttgcaccaagt
cctgcaaaagtaggaacagacaatgatcaaccagcttttacacttccggatctttctgaa
cagttttcacctcctgataatgccccgccattcctcgtcaagttagtggaagccatcgaa
agaaaaggactggaatgttcaacgttgtacagaacacaagggtcaagcagcattgcagaa
ttaagacaaattacagagtgtgatctttcaacagtggattttgatgccattgatctgcag
attttatcagatgctttgaagaggtactttctggacctgccaaatcctgtcattccagca
tctgtttacaatgaaatgattcccacagcacaagaagggcagaactcagaggaatctgct
caggtgctgaagaagctcatcagatcgcctaatatacctcaacagtattggcttaccctc
caatatctgctcaaacatttctccagactttgtcagacttctaccaaaaatcttttgaat
gcaagatcattggctgaaatttttagcactctgctattcaggtcccaggtagcaagctct
gacagttttgaacaccacattaagatcttggaactgttaattacaagtgaatggaatgaa
agacaacctgcaccagcactgcctcctaaacctccaaagcctaatactgtaataaataac
ggtatgaataacaacatgtctctgcaagatgctgaatggtactggggagatatctcaagg
gaggaagtaaatgagaagcttcgcgacactgctgatggtaccttcttggtacgagatgcc
tccaccaaaatgcatggggactatacacttacattacggaagggaggaaataataaatta
attaaaatatttcaccgagatgggaaatatgggttttctgatccattaacgttcaattct
gtggttgagctaataaaccactacaggaatgagtctttagctcagtataatccaaaattg
gatgttaaattgctttatccagtatccaaatatcaacaggatcaagtggttaaagaggat
agtattgaagcagtgggaaagaaattgcatgaatataacatccagttccaagaaaagaac
agggagtatgacaggctgtatgaagactacacaagaacatctcaggaaattcaaatgaaa
agaactgccattgaggcatttaatgaaaccataaaaatatttgaagagcagtgccaaaca
caggaaagatacagcaaagaatatattgaaaaatttaagcgggaggggaatgaaaaagaa
atacaaagaattatgcacaactatgaaaaactgaaatctcgaatcagtgaaatcgtggat
agccggcgtagactggaagaggatttaaagaagcaagctgcagaatacagggagattgat
aagcgcatgaacagcattaaaccagaccttatacagctcagaaagacaagagatcagtac
ttgatgtggttgactcagaagggtgttcgacaaaagaaattgaacgaatggctcggaaat
gaaaatacagaagatcagtactctatggtggaagatgatgaggatttgccccatcaagat
gagcgaacgtggaatgtgggaaatatcaatcgaagccaagctgaaaatctactacgtggc
aaacgtgatggaacattccttgttcgggagagcagcaaacagggctgctacgcctgctct
gttgttgtggatggtgaagtgaagcactgcgtcatcaacaaaacacctactgggtatgga
tttgcagagccatataatttgtacaactcactgagagaactggtgctacattatcaacac
acgtcgctcgttcagcacaatgactctctcaacgtcacactagcctatccagtatatgca
cagcaaaggcgatga

KEGG   Gekko japonicus: 107110507
Entry
107110507         CDS       T04299                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
gja  Gekko japonicus
Pathway
gja00562  Inositol phosphate metabolism
gja01100  Metabolic pathways
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107110507 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107110507 (PIK3CB)
   04370 VEGF signaling pathway
    107110507 (PIK3CB)
   04068 FoxO signaling pathway
    107110507 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    107110507 (PIK3CB)
   04150 mTOR signaling pathway
    107110507 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107110507 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    107110507 (PIK3CB)
   04218 Cellular senescence
    107110507 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107110507 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107110507 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107110507 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    107110507 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107110507 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    107110507 (PIK3CB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107110507 (PIK3CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107110507 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107110507 (PIK3CB)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107110507 (PIK3CB)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107110507 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD DUF4135
Other DBs
NCBI-GeneID: 107110507
NCBI-ProteinID: XP_015266783
LinkDB
Position
Un
AA seq 1068 aa
MPPAMADTLDIWAVDSQIAADGSISVDCLLPTGIYISLDVPRDATISHIKQLLWKQAHSY
PLFHLLMEIDSYMFSCVNQTAVREELEDETRRLCDVRPFLPVLQLITRSCDPGEKLDSKI
GVLIGKGLQEFDALQDPEVKEFRDKMGRISEEKMKSLIRLSWIDWLKRTYPPEQEPAIPE
NLQDKLYGGNLVVAVHFDNCQDVFSFQVSPNINPIKLNELAIRKRLTIHGREDEAVDPYN
YVLQVSGRLEYVFGDQPLIQFQYIHCCVMNRILPQLTLVECSSIKKMCEQEMIAIEAAIS
RKSSLPLPLPPKKSRTVALTQSVWDITLPFKVVLVSGTKLNTDETAKVHVRAGLFHGTEL
LCKPIVSSEISGRNDHVWNEPLEFDINVCDLPRMARLCFVVYAVMDKMKNKKSAKTLNPS
KYQTIRKAGKVHYSVAWVNTMVFDFKGQLKMGDFVLHSWSSFPDELEEMLNPMGTVQTNP
YTENATALHIRFQEYSKLPIYYPPFDKILEKAAEIARNSDSSGMAGRGGKKFYIELKEIM
ERDPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQIWAKLP
PREALELLDFNYPDQYVREYAVGCLRHMSDEELAQYLLQLVQVLKYEPFLDCALSRFLLE
KALANRRIGQMLFWHLRSEVHIPAFSVQFGVILEAYCRGSVAHMKVLSKQVEALNKMKTL
NSLIKLNAVKQSKAKAKDAMHTCLKQRAYKEALSDLQSPLNPSVILSELYVEKCKYMDSK
MKPLWIVYNNKVFGGDLVGIIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRIVPYGCL
ATGDHSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWIKEYNSGDDLDRAIEAFT
LSCAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTY
DFIHVIQQGKTGNTEKFCRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQ
YLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcctgccatggcagataccctggacatctgggcagtagattcacagatagcagcc
gatggctcaatatctgtggactgcctcctacccactggaatctatataagtctagatgtc
ccacgtgatgccaccatttctcatataaagcagctcttatggaagcaagcacacagctac
cctctatttcaccttcttatggaaatagactcctatatgttctcctgcgtgaatcaaaca
gcagtacgtgaggaactagaagatgaaacacgaaggctctgtgatgttcgaccatttctt
cctgtccttcaactaattacaagaagctgtgacccaggagaaaaattggactccaagata
ggcgtcctcataggaaaaggtctccaagagtttgatgccttacaagacccagaagtaaaa
gaattcagagataagatgggacgaatcagtgaagaaaagatgaagtcacttataaggtta
tcttggattgactggctaaagcgcacttatcctccagaacaagaaccagcgatcccagaa
aacctccaagataaactctatggtggcaatctcgttgtagctgttcattttgataactgt
caggatgtatttagtttccaggtttctcctaacataaaccctatcaaattgaatgaactg
gcaattcggaagcgtttgactatccatggaagggaagatgaagcagttgatccttataac
tatgtgctgcaagtcagcggaagactagaatatgtctttggggaccaaccattaattcag
ttccagtatatccattgctgtgtgatgaacagaattcttcctcagttgactcttgtcgaa
tgtagcagcataaagaaaatgtgtgaacaggaaatgatagccatagaagctgccataagc
cgaaaatccagccttcctcttcctctgccacccaaaaaatcacgaacagtagctttgact
caaagtgtatgggatattaccctccctttcaaggtggtgctggtaagtgggaccaagttg
aacacagatgagactgctaaagttcatgtcagggctggtctcttccatggaactgagctc
ctttgtaagcctatcgtaagctcagaaatatctgggagaaatgaccatgtttggaatgag
cccttggaatttgatatcaacgtctgcgacttgccaagaatggctaggctgtgctttgtg
gtttatgctgtgatggacaaaatgaaaaataaaaagtcagccaagacacttaatccttcc
aaataccagactattaggaaagctgggaaagtgcactattctgtagcttgggtcaatacc
atggtgtttgactttaaaggacagttgaaaatgggagactttgtactgcacagctggtcg
tcatttcctgatgaacttgaagagatgttgaatccaatgggaacagtacagacaaatcca
tacactgaaaatgcaacagctttgcacatcagatttcaagagtattcaaaactccctatt
tattaccctccctttgataagatacttgaaaaggcagctgagatcgcaagaaatagtgat
agttctggtatggcaggccggggtggcaaaaagttctacattgagctaaaggagatcatg
gaaagggatcctttgtctcagctctgtgaaaatgaaatggatctcatttggactttgcga
tatgactgccgtgagaattttccacagtccctgccaaagctattgctctctgtcaagtgg
aacaagcttgaagatgttgctcagcttcaggcccttcttcaaatatgggccaaactgcct
cccagagaagcattagaattattggatttcaattatccagatcaatatgtgcgagaatat
gcagtaggctgtttaaggcatatgagtgatgaagaacttgctcagtatcttctgcagctt
gtacaagtactgaaatatgaaccttttctcgactgtgccctctccaggttcctgctagag
aaagcactggcaaacaggagaataggacagatgctgttttggcatctgagatcagaagta
catatacctgcattttcagtacagtttggcgtgattcttgaagcttactgccgtggaagt
gttgctcatatgaaagttctctctaaacaggttgaagcactgaacaagatgaagactttg
aatagtctaataaagttgaatgctgtgaagcaaagcaaagcgaaagcaaaagacgcaatg
cacacctgtttaaaacaaagagcttacaaagaagccctttctgatctccagtctcctctg
aatccttcagtcatactttcagaactgtacgtggagaaatgtaaatacatggactctaaa
atgaagcctttatggattgtatataacaacaaagtgtttggtggagatttggtggggatc
atctttaaaaatggagatgatctgcggcaagacatgctgacgcttcagatgttacgtttg
atggacttgctttggaaagaagctggtctggatcttcgaatcgtgccatatggttgttta
gcaacgggagatcattctggtttaattgaggttgtttccacgtctgagaccattgcagat
attcaactgaatagtagcaatgtggctgctgctgctgcattcaacaaagatgctctctta
aattggattaaggaatacaattcaggagatgacttggatcgagctattgaggcattcact
ctctcttgtgctggctactgtgtagctacttatgtgctgggcataggagacagacatagt
gacaatatcatggtcaggaagaatggacagctcttccatatagattttggccacattctt
ggaaacttcaaatccaaatttggaattaaaagggagcgagtgcctttcattcttacgtat
gattttattcatgtcattcagcaagggaaaactggaaacactgaaaaattttgccggttc
cgacagtgttgtgaagatgcatacttgattctgagaagacatgggaacctattcatcact
ctctttgcattgatgctaacagccgggcttccagagctaacctctgttaaggatatccag
tatctaaaggactctcttgccttagggaagagtgaggaagaggcactaaagcagtttaag
cagaaatttgatgaagcgctgagagaaagctggactactaaagtgaactggatggcacat
actgttcggaaggattatagatcctga

KEGG   Gekko japonicus: 107110982
Entry
107110982         CDS       T04299                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
gja  Gekko japonicus
Pathway
gja00562  Inositol phosphate metabolism
gja01100  Metabolic pathways
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107110982 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107110982 (PIK3CA)
   04370 VEGF signaling pathway
    107110982 (PIK3CA)
   04068 FoxO signaling pathway
    107110982 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    107110982 (PIK3CA)
   04150 mTOR signaling pathway
    107110982 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107110982 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    107110982 (PIK3CA)
   04218 Cellular senescence
    107110982 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107110982 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107110982 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107110982 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    107110982 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107110982 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    107110982 (PIK3CA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107110982 (PIK3CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107110982 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107110982 (PIK3CA)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107110982 (PIK3CA)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107110982 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 IL3Ra_N DUF5314 Ribosomal_S15
Other DBs
NCBI-GeneID: 107110982
NCBI-ProteinID: XP_015267337
LinkDB
Position
Un
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLNIKHELFKEARKYPLYH
LLQEESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDPEVQDFRRNILNVCKEAVDLRDANAPHSRALYVCPPNIESSPDLPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKHPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
NFTMPSYSRRISTATPYMNGEASAKSLWVINSNLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLQYEMHILDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSPVKFPDMSVIEEHANWTISRELGYNYSPAGQSSRIARDNELSESDKEQLRAICTRDPL
SEITEQEKDFLWRHRHYCVNMPEILPKLLLSVKWNSRDEVTQMYCLIKDWPPIKPEQAME
LLDCNYPDRMVRAFAVRCLEKFLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKNVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGTLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHALHQWLKDKNKGEMYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatctggtgaactgtggggcatccacttgatgccccctagaatc
cttgtggaatgtcttctacctaatggtatgatagtgactttagaatgcctccgtgaggcc
acattgttaaatattaaacacgaactctttaaagaagctaggaaataccctctctaccat
ctccttcaagaggagtcatcttacattttcgtaagtgttacccaagaagcagaaagagaa
gaatttttcgatgaaacccggagattatgtgacctgcggctttttcaaccttttctaaaa
gtcatagaaccagtaggcaacagagaagagaaaattctgaatcgtgaaattggttttgct
attggcatgcctatctgtgaatttgacttggttaaagatccagaagttcaggacttcaga
agaaacattctgaatgtctgtaaagaagctgtagatcttcgagatgctaatgcgccccat
agcagagcactatatgtctgtccccccaacatagaatcatcgcctgatttgcccaagcat
atatacaataaattagataaagggcaaataatagtggtcatctgggtaatagtctctccc
aataatgacaagcagaaatacaccttaaaaatcaatcatgactatgtgccagagcaagta
atcgcagaagcaatcaggaaaaaaacacggagtatgttactgtcatcggagcagctaaag
ctatgcgttttggagtatcagggaaagtatattttaaaagtgtgtggttgtgatgaatac
ttgctagaaaaacatcccctgagtcagtataagtacatccgaagttgtatcatgcttggt
cgaatgcccaacctcatgctgatggcaaaggaaagcctttacacccagctgccattggat
aacttcacaatgccatcttattccaggcgtatctctacagctacgccatacatgaatggt
gaagcttcagccaaatctctctgggttattaacagtaatctcagaataagaattctctgt
gccacctacgtaaatgtaaatattcgagatattgacaagatctatgtccgaactggtatc
tatcatggaggagaaccattgtgtgataatgtgaatactcagagagtaccttgctccaat
cccagatggaatgaatggctgcagtatgagatgcatatccttgatctcccacgtgctgcc
cggctttgcctttctatctgctcagttaaaggtagaaagggtgcgaaggaggagcactgc
ccattggcgtgggggaacattaacatgtttgattacacagacactcttgtttctggcaaa
atggctctgaatctgtggcccgtacctcatggtctggaagacctgctcaatcccattgga
gttactggatcaaacccaaataaggaaactccatgtttagagctggaatttgattggttt
agcagtcctgtaaagtttcccgacatgtcagtgattgaagaacatgccaattggactatc
tctcgagaactagggtataactacagtcctgctgggcagagcagtagaatagctagagac
aacgaactgagtgaaagtgacaaagagcagctccgtgcaatttgcactcgagatcccctg
tctgaaataactgaacaagagaaggacttcctctggaggcacaggcattattgtgtaaat
atgccagaaattctacccaagctgcttttgtctgttaagtggaactccagagatgaagta
acccagatgtactgcttgatcaaagactggcctcccatcaaacctgagcaggcgatggaa
cttctggactgcaactaccccgatcggatggtgcgtgcttttgcagtgcggtgtctggaa
aaattcttgacagatgataagctgtctcagtatttgattcaactggtgcaggttctaaaa
tatgagcaatacttggataatctgttagtgaggtttttactgaagaaggcgctgaccaat
caaagaataggacatttcttcttttggcatctcaagtctgaaatgcacaacaaaaatgtg
agccagaggtttggtctgcttttggaatcctattgccgagcatgtgggatgtacctaaaa
catctgagcaggcaggtagaagctatggaaaaactgattaacctcacagacatcctcaag
caagagaaaaaggatgaaacgcaaaaggtacagatgaagttccttgtggagcaaatgagg
cggccagacttcatggatgcattgcaaggctttatatctcctctcaatcctgctcatcag
cttggaacccttaggcttgaggagtgcagaattatgtcgtctgcaaaaaggccattgtgg
ctcaattgggaaaacccagatattatgtctgagctgctgtttcagaacaatgagatcatc
ttcaaaaacggggatgatctgcgccaagatatgctgacgcttcagatcatccgaattatg
gaaaatatctggcaaaatcaaggtcttgatcttaggatgcttccttatggttgtttatcg
attggtgactgtgtggggctcatcgaagttgtgaggaattcgcacacaatcatgcaaatt
caatgcaagggtggccttaaaggtgcgctgcagttcaacagtcatgcgttacaccagtgg
ctcaaagacaagaacaaaggggaaatgtatgatgcagctattgatttgtttacacgctct
tgtgctggctattgcgtggcgaccttcatactgggaattggcgatcgtcacaatagcaat
atcatggtgaaagatgatgggcagctgttccacattgattttggacatttcttggatcac
aagaagaagaagtttggatacaaacgtgagcgggtgccctttgtcttaacgcaagatttc
ttgatagtgattagcaaaggagcccaagaatgtaccaaaacaaaggaatttgaaaggttt
caagaaatgtgttacaaagcttacttagccatccggcagcatgccaacctcttcataaac
ctcttctccatgatgctcggttcgggaatgccagagctgcagtcttttgacgacattgca
tatattcggaagacactggcattggacaaaactgagcaggaagcacttgagtatttcatg
aagcagatgaacgatgctcatcatggcggctggacgacaaaaatggactggatcttccat
acaatcaagcaacacgctttgaactga

KEGG   Gekko japonicus: 107118085
Entry
107118085         CDS       T04299                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
gja  Gekko japonicus
Pathway
gja00562  Inositol phosphate metabolism
gja01100  Metabolic pathways
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107118085
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107118085
   04370 VEGF signaling pathway
    107118085
   04068 FoxO signaling pathway
    107118085
   04070 Phosphatidylinositol signaling system
    107118085
   04150 mTOR signaling pathway
    107118085
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107118085
  09143 Cell growth and death
   04210 Apoptosis
    107118085
   04218 Cellular senescence
    107118085
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107118085
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107118085
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107118085
   04625 C-type lectin receptor signaling pathway
    107118085
  09152 Endocrine system
   04910 Insulin signaling pathway
    107118085
   04914 Progesterone-mediated oocyte maturation
    107118085
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107118085
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107118085
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107118085
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107118085
Membrane trafficking [BR:gja04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107118085
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 PI3K_rbd PI3K_p85B Ribosomal_S15 C2
Other DBs
NCBI-GeneID: 107118085
NCBI-ProteinID: XP_015275811
LinkDB
Position
Un
AA seq 1072 aa
MPPRPSSGELWGLHLMPPRIMVDCCLPNGMIVTLECLREATLLGIKHDLFKEARKYPLFH
LLQDESSYIFVGVTQEAEREEFYDESRRLCDLRLFQPILKVIEPVGNREEKILNREIGFA
IGMPICEFELVKDPEVQEFRRNILSVCREAVETRGAVGPQSQALYVYPPNVESSPELPKH
VYSKLDKGRIIVTIWVIVSPNNDKQKYTLKTPHDALPEQVIAEAIRKKTRSMHLSPEQLR
LCVQEYQGKYLLKVCGCDEYLLEKYPLSQYKYMRNCIAIGRLPHLMLMSKESLYGQLPAN
VFVLPSYARRSAPSSHVNGDVPTKSLWSINSLLRIKILCATYVNVNIRDIDKIYVRTGIF
HGGEPLCDNVNTQRVPCSNPRWNEWLSYDIYLTDLPRAARLCVSICSVKGRKGAKEEHCP
LAWGNVNLFDYKDTLVAGKMALNLWPVPHGLEDLLNPIGVGGSNPNKETPCLELEFTWYS
HTVKFADAAEIEEHANWAMSRELGLNYCMVGLSNRLARDSSLDESELEQLRNICNRDPLS
EITEQEKDFLWRHRHYCVNIPETLPKLLLSVKWNSRDEVAQMYCLLREWPLIKPELSMEL
LDCNFPDPVVREFALKCLVKGLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLTMKALTNQ
RIGHFYFWHLKSEMHSKPVSQRFGLMLEAFCRGCGMYLKHLNRQVEAMEKLINLTDILKQ
EKKDETQKMQMKFLVEQMRRPDYMEALQGFICPLNPVHQLGNLRLDECRIMSSAKRPLWL
NWENPDIMSELLFTNHEIIFKNGDDLRQDMLTLQIIRIMESMWQNQGLDLRMLPYGCLSI
GDCVGLIEVVKSSHTIMQIQCKGGLKGALQFNSNALHHWLKDKNKGEGYDAAIDLFTRSC
AGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFL
IVISKGVQECTKTKEFERFQEMCYKAYLTIRQHANLLINLFSMMLGSGMPELQSFDDVAY
LRKTLALDKSEQEALEYFTKQMNEAHHGGWTTKMDWIFHTIRHMPLSEASHD
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgccgccacggccctcgtccggggagctgtgggggctccacctcatgcccccgcggatc
atggtggactgctgcctacccaacggcatgatcgtcaccctggaatgtctgcgggaagcg
actcttctggggatcaagcatgaccttttcaaggaggccaggaaataccctctcttccac
ctcctgcaggacgaatcttcctacatctttgtgggggtgactcaggaagcagagagggaa
gaattctacgatgagtcacggcgcctctgtgatctgcgcctcttccaacccatcctcaag
gtcatcgagccagtgggtaaccgagaggagaagatcttgaaccgggagattgggtttgcc
atcgggatgcccatctgtgaatttgagctcgtcaaggaccctgaggtgcaagaattccgg
agaaatatcctctctgtttgccgcgaagccgtggagacacggggggcagttgggccccaa
agccaggccttgtatgtctacccccccaacgtggagtccagtccagagctgcccaaacat
gtctacagcaaactggacaaaggtcggatcatagtgaccatttgggttattgtgtctcca
aacaacgacaaacagaaatataccctcaagacgccgcacgatgcgctgcccgagcaggtg
atcgccgaggccatccgaaagaagacccgcagcatgcacctgtcgccagagcagctgcgc
ctgtgtgtgcaggagtaccaggggaagtacctcctgaaggtgtgcggctgcgacgagtat
ttgctcgagaaatatccgctcagtcagtacaagtacatgaggaactgcatcgccattggc
cgcctgccccacctgatgctcatgagcaaggagagcctctatggccagctgccggccaac
gtgttcgtgctgccctcctacgcacgccgctcggccccttcctcgcacgtcaatggagac
gtccccaccaagtcactctggtctatcaacagccttctgcgaatcaagatcctgtgtgcc
acctacgttaatgtcaacatccgcgatatcgataagatctatgtccggacaggaattttc
cacggtggggagcccctttgtgacaacgtgaacacccagcgcgtcccctgctccaaccct
cggtggaacgagtggctctcctacgacatctatctcactgacttaccacgagcggcccgc
ctctgcgtgtcaatctgctcagtgaaaggccggaagggggccaaggaggagcactgcccc
ctcgcctggggcaacgtcaacctctttgattacaaagacaccctggtggctgggaagatg
gcgctcaacctgtggcccgttccccatggcctggaggacctgcttaaccccatcggagtg
gggggctccaaccctaataaggagaccccttgcctggaactggagttcacctggtacagc
cacacggtcaagtttgctgacgccgccgaaatagaggagcacgccaactgggccatgtct
cgggagctggggctcaactactgcatggtggggctgagtaaccgtctggcccgggacagc
tcccttgacgaaagcgagctggagcagctccggaacatttgcaaccgggaccccctttca
gagatcactgagcaagagaaggacttcctgtggagacaccggcactactgtgtcaacatc
ccggagaccctccccaaactactgctgtctgtcaagtggaattcacgggacgaggtggct
cagatgtactgcctcctccgggagtggccactcatcaaaccagagctctccatggaactc
ctggactgcaatttcccggacccggtggtgagggagttcgccctgaagtgcctcgtgaag
ggcctgacagacgacaagctctctcagtatctcatccaactcgtgcaggttctcaagtac
gagcagtatttggacaaccccctggcccggttccttaccatgaaggccctgacaaaccag
cggattggacacttctacttctggcatctcaagtcggagatgcacagcaagcccgtttct
cagcgcttcgggctaatgctggaggccttctgccgtggctgcgggatgtacctgaagcac
ctgaaccggcaggtggaggccatggagaaactcatcaacctgaccgacatcctgaagcaa
gagaagaaggacgagacgcagaagatgcagatgaagtttctggtggagcagatgaggagg
ccggattatatggaggcgcttcagggctttatctgtccactcaaccccgtacaccagcta
ggcaacctccggttggacgagtgccggatcatgtcttctgccaagaggccgttgtggctg
aactgggagaatcccgacatcatgtccgagctgctcttcacaaaccacgagatcattttc
aaaaacggagacgacctccggcaagatatgctcacgctgcagatcatccggatcatggag
agcatgtggcagaaccaggggctggaccttcggatgctgccctacggctgcctgtccatc
ggggactgcgtgggcctcatcgaggtggtgaagagctcccacaccatcatgcagatccag
tgcaagggaggcctgaagggggcgctgcagttcaacagcaacgccctgcaccactggctg
aaggacaagaacaagggagagggttacgatgcagccatcgacctcttcacgcgctcctgt
gccggctactgcgttgccacgtttattctgggcatcggggaccggcacaacagcaacatc
atggtgaaggatgacggacagctcttccacatagattttgggcacttcctggaccacaag
aagaagaaatttggctacaagcgggaacgagtcccctttgtcctcacccaggatttcctc
atcgtcatcagcaagggggtgcaggagtgtacaaagaccaaagagtttgagaggttccag
gagatgtgctacaaggcctacctgaccatccgccagcacgccaacctgctcatcaacctc
ttctccatgatgctgggctccgggatgccggagctccagtccttcgacgacgtggcctac
ctgcgcaagaccctggccctggacaagtccgagcaggaggcgctcgagtacttcaccaaa
cagatgaacgaggcccaccacggcggctggaccaccaagatggactggatcttccacacc
atccgccacatgcccttgagcgaggccagccacgactga

KEGG   Gekko japonicus: 107119473
Entry
107119473         CDS       T04299                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
gja  Gekko japonicus
Pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107119473 (PIK3R3)
   04370 VEGF signaling pathway
    107119473 (PIK3R3)
   04068 FoxO signaling pathway
    107119473 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    107119473 (PIK3R3)
   04150 mTOR signaling pathway
    107119473 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107119473 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    107119473 (PIK3R3)
   04218 Cellular senescence
    107119473 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107119473 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107119473 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107119473 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    107119473 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107119473 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    107119473 (PIK3R3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107119473 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107119473 (PIK3R3)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107119473 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF5638 Transcrip_act
Other DBs
NCBI-GeneID: 107119473
NCBI-ProteinID: XP_015277436
LinkDB
Position
Un
AA seq 462 aa
MYNTVWDMDRDDTDWREVMMPYSTELIFYIEMDPPALPPKPSKPMTTVNTNVIKENCSSS
LQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKKQGDYTLTLRKGGNNKLIKIYHRD
GKYGFSDPLTFCSVVELINHYRHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGK
KLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYSKE
YIERFRKEGNEKEIERIMMNYEKLKSRLGEIHDSKLRLEQDLKKQALDNREVDKKMNSIK
PDLIQLRKIRDQYLVWLNHKGVRQKRINNWLGIKNENIDDTYFTNEEDENLPHYDEKTWF
VGDINRIQAEDLLGGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTPRGYGFAEPY
NLYSSLKELVLHYQHTSLVQHNDSLNVRLAYPVYAQMPSLCR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtgggatatggatcgcgatgacacggactggagggaggtgatgatg
ccgtattccaccgagttgatattctatattgaaatggaccctccagctcttcctccaaag
ccctccaaaccaatgactacagtaaatacaaatgtcataaaagagaattgcagttcttca
ctacaggatgcagaatggtattggggagacatttcaagggaagaggtaaatgataaacta
cgagatatgccagatggaacattcctggtgcgagatgcatcaacaaagaagcagggagac
tatactctgacactgcgaaaaggcggcaacaataaattgataaaaatttatcatcgagat
ggaaaatatggtttttctgatccactgacattttgttctgttgtggagctgattaaccac
tatcgccatgagtctcttgcccagtataaccctaagcttgatgtgaagctgatgtatcct
gtgtctagatatcaacaggaccagttggtgaaagaagataatattgatgctgtgggcaaa
aagctgcaggaataccacagtcaatatcaagagaaaagtaaagagtatgacaggttatat
gaagaatataccagaacctcacaggaaattcagatgaagagaacagcaatagaagctttt
aatgaaacaattaaaatatttgaagaacagtgtcacacccaagagcagtatagcaaagaa
tacattgaaagattccgaaaagaagggaatgaaaaggaaattgaacgtattatgatgaat
tatgaaaaattgaaatcacgtctgggtgagatccatgatagcaagctgcgattggaacaa
gatttgaagaagcaagccctggacaaccgggaagtcgataagaaaatgaacagtatcaaa
cctgatcttatccagctgcgcaaaatcagagatcagtaccttgtctggcttaatcacaaa
ggagtgagacagaagcgaataaacaactggctgggaatcaaaaatgaaaatattgacgat
acatactttacaaatgaggaagatgaaaatctgccacattatgatgaaaagacttggttt
gttggagatatcaatcgtattcaagcagaagatttgcttggtgggaaacctgatggagca
ttcttaattcgtgaaagtagcaaaaaaggctgttatgcctgttctgtggtagctgatggg
gaagttaaacactgtgtgatctacagcactccaagaggttatgggtttgcagagccatat
aacctatatagctcccttaaagaattagttcttcattaccagcatacctccctcgtccaa
cacaacgactccctcaatgtcaggctcgcttaccctgtctatgcacagatgccctccctc
tgtagataa

KEGG   Gekko japonicus: 107121678
Entry
107121678         CDS       T04299                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
gja  Gekko japonicus
Pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04070  Phosphatidylinositol signaling system
gja04140  Autophagy - animal
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04218  Cellular senescence
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04620  Toll-like receptor signaling pathway
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107121678 (PIK3R2)
   04370 VEGF signaling pathway
    107121678 (PIK3R2)
   04068 FoxO signaling pathway
    107121678 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    107121678 (PIK3R2)
   04150 mTOR signaling pathway
    107121678 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107121678 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    107121678 (PIK3R2)
   04218 Cellular senescence
    107121678 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107121678 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107121678 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107121678 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    107121678 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107121678 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    107121678 (PIK3R2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107121678 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107121678 (PIK3R2)
Membrane trafficking [BR:gja04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107121678 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP ATG11
Other DBs
NCBI-GeneID: 107121678
NCBI-ProteinID: XP_015280130
LinkDB
Position
Un
AA seq 631 aa
MGSAEGFQYRALYPYRSILPELSEQFVPPDVAPPLLCRLVDAIEKKGLESKMLYRAPGAE
LRPALRTDWAAAGDLEAYDVLSLGEALKGYLQELPTPVVPDRVHGEILRVLQDASQPERD
RAQLLSVLEPPSLPLPHLLTLQFLLRHWAKVAEQAESNGLRPWALGEIFGPLLLRRPAGA
STETGPDFSVLFLEALLQTTEPRLEQPPPALPPKPPKPKPTAAVLANGNGVTLQDAEWYW
GDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKIFHREGQYGFSEP
LTFGSVVELISHYRHESLAQYNAKLDTRLLYPVSKSQQDQVVKEDSVEAVGEQLKVYHQQ
YQDKSREYDLLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQCQIQEKCSREYIERFRRE
GNDKELQRILMNSEKLKSRVSEIHDSKRKLQQDLKQQASENREIDKRMNSLKPDLLQLRK
LRDQYLVWLTQKGTRQKKINEWLGIRNESEDQYFTMEDEEELPHHEERTWYVGKINRTQA
EEMLAGKRNGTFLIRESSQRGCYACSVVVDGDTKHCVIYKTVTGYGFAEPYNLYASLKEL
VLHYKHTSLVQHNDSLNVTLAHPILSPPLPR
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggggagcgccgaggggttccagtaccgggccctctacccgtaccggtcgatcctcccg
gagctttcggagcagtttgtcccccctgatgtcgcccctccgctcctgtgccggctggtg
gatgccattgaaaagaaggggctggagagcaagatgctgtacagggcaccaggggctgaa
ctgaggccagcgctgagaaccgactgggcagcggctggcgacttggaggcgtacgacgtg
ctgtccctcggcgaagccctcaagggatacctgcaagagctgccgaccccagtggtgccc
gacagagtccacggcgagatcctgcgggtgctgcaggatgccagccagccggagcgcgac
cgggcgcagctgctgtctgtgctggagccccccagcctgccgctgccccatctcctcacc
ctccagttcctcctgcgccactgggcgaaagtggccgagcaagcggagagcaacgggctg
cggccctgggccctgggcgagatcttcggtcccctgctccttcggcggcctgctggggcc
agcaccgagacgggccccgacttctccgtgctcttcctggaggctcttctgcagaccacg
gagcccaggctggagcagccccctccagcgctgccccccaagccccccaagcccaagccg
acggcagcagtcctggccaatgggaatggtgtgactctgcaggatgccgagtggtactgg
ggcgacatctccagggaggaagtgaacgagaagctccgagacactcccgatgggacgttc
cttgtccgggatgcatccagcaagatccagggcgaatacactctgacgctgcggaaaggg
ggcaacaacaagctgatcaagatcttccatcgggagggccagtacggcttctcggagccg
ctgaccttcggctccgtggtggaactcatcagccactaccggcacgagtctctggcccag
tacaacgccaagctggacacgcggctgctgtaccccgtctccaagtcccagcaggaccag
gtggtgaaggaggacagcgtggaggccgtgggggagcagctgaaggtctaccaccagcag
taccaggacaagagccgcgagtacgaccttctctacgaggagtacacgcgcacctcgcag
gagctgcagatgaagaggacggccatcgaggccttcaacgagaccatcaagatcttcgag
gagcagtgtcagatccaggagaagtgcagccgggagtatatcgagcggttccggagggag
gggaacgacaaggagctgcagcggatcctgatgaactcggagaagctgaagtcccgcgtc
tccgagatccacgacagcaagaggaagctgcagcaggacctcaagcagcaggcctccgag
aaccgcgagatcgacaagcgcatgaacagtctcaagcccgatctgctgcagctgcgcaaa
ctgcgggaccagtatctggtgtggctgactcagaaggggacccgccagaagaagatcaac
gagtggctgggcatcaggaatgagagtgaggaccagtactttacgatggaggacgaggag
gagctgccccatcacgaggagcggacgtggtacgtgggcaagatcaaccgcacccaggcc
gaagagatgctggccggcaagcggaacgggaccttcctcatccgggagagcagccagcgc
ggctgttacgcctgctcggtcgtggtggatggcgacaccaagcactgcgtgatctacaag
acagtgaccggctacggcttcgccgaaccctacaacctctacgcctccctcaaggagctg
gtcttgcactacaagcacacctcgctggtgcagcacaacgactccctcaacgtcacgctg
gctcaccccatcctctctccacccctccccagataa

DBGET integrated database retrieval system