KEGG   Gekko japonicus: 107107812
Entry
107107812         CDS       T04299                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04068  FoxO signaling pathway
gja04150  mTOR signaling pathway
gja04210  Apoptosis
gja04620  Toll-like receptor signaling pathway
gja04621  NOD-like receptor signaling pathway
gja04622  RIG-I-like receptor signaling pathway
gja04623  Cytosolic DNA-sensing pathway
gja04625  C-type lectin receptor signaling pathway
gja04910  Insulin signaling pathway
gja04920  Adipocytokine signaling pathway
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107107812 (IKBKB)
   04068 FoxO signaling pathway
    107107812 (IKBKB)
   04150 mTOR signaling pathway
    107107812 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107107812 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107107812 (IKBKB)
   04621 NOD-like receptor signaling pathway
    107107812 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    107107812 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    107107812 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    107107812 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107107812 (IKBKB)
   04920 Adipocytokine signaling pathway
    107107812 (IKBKB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107107812 (IKBKB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107107812 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107107812 (IKBKB)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     107107812 (IKBKB)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107107812 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH ubiquitin Glyco_hydro_65m TBK1_ULD YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107107812
NCBI-ProteinID: XP_015263643
LinkDB
Position
Un
AA seq 766 aa
MAPPPLPPPPPPAPLQSVGCCGPWEMRERLGTGGFGNVIRWHHKETGEQIAIKQCRQELS
PRNRERWCLEIQIMKRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRRYLNQL
DNCCGLQERSILILLSDIASALRYLHENRIIHRDLKPENIVLQQGDGRLIHKIIDLGYAK
ELDQGSLCTSFVGTLQYLAPELLEQLKYTVTVDYWSFGTLTFECITGFRPFLPNWQPVQW
HAKVRQKSELDIVVYEDLSGEVKFSSKLPQPNNLNCVLADRLEKWLQMMLKWNPRQRGTD
PTYGPNGCFKALDDILNIKLVHILNMVTGVIHVYSLAEDETLQNVKARIQADTGIPEQDQ
ELLQEGGLALFPEKPDIQYLADSKLNDIAATDADLFFLFDNRKDTYEPQISLRPHPESIN
YILQDPKKTLSFFQLRKVWGQVWHSIQKLNRDFNQLQHGQRAAMRNLLRHNSTLSKMKNS
MASLSQQLKAKLDFFKTSIQIDLEKYNEQTEFGITSEKLLLAWKEMEQDVELCGQEEEVE
ELVKKTMALQTEIVDLQRIPQGRKQGSSLDDLEEQAKDLYRRLREKPRDQRTSGDCQDVV
RLLLQAIQMFEKKVRLLYVQLSNTVVCKQKALKLFPKVDEVMHLMNEDEKKVIGLQEKRQ
KELWNLLKIACSKVRGPVSGSPDSMNISRLSNPGQLSLQSSAPNGNLQEPVLKSEVLLME
SQSLCSQLENVMLDTMKDQDHSFMALDWSWLKLQVEERENPEQTQM
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggcgcctcctcctcttcccccgccgccgcctcccgcgcccctccagtcggtgggctgc
tgcggcccgtgggagatgcgggagcgtctcggaactggaggcttcggcaacgtcatccgc
tggcaccacaaggagactggggagcaaattgccattaaacagtgccgtcaggagctcagc
ccccgcaacagagaaagatggtgtctggaaatacagataatgaaacgactaaatcacccc
aatgtggtggctgcccgtgatgtcccagaagggatgcagaatcttgcccctaatgacttg
cccctgttggctatggagtactgccagggaggagatcttagaaggtatctaaaccagctt
gataactgctgtggcctgcaggaaagatctatcctcatcttgctgtcagacattgcttct
gctctcagataccttcacgagaacagaatcatccacagagacttgaaaccagagaacatt
gttctgcaacaaggagatggaaggctaatacacaagatcattgatctgggatatgccaaa
gagctggatcaaggcagcctttgcacttctttcgttgggacactgcagtacctggcaccg
gaactgctggagcagctgaagtacacagtgacggttgattactggagttttggcacactg
acatttgagtgcataacaggtttccgaccttttctgcccaactggcaaccagtgcaatgg
catgcaaaagtgaggcagaaaagtgagctggatattgttgtctatgaagacttgtctgga
gaagtgaaattttctagcaaattgccacagcccaataatctgaactgtgtgttggctgat
cgactggagaaatggctacagatgatgcttaaatggaacccacggcagagaggcactgac
cccacatatggccccaatggctgtttcaaggccttggatgacatcctgaatattaaacta
gttcatatcctgaatatggtaacaggcgtaattcacgtatacagtctggcagaggacgag
accttgcagaatgtgaaagccaggatccaggctgatactggcatcccagagcaggaccag
gagttgctgcaagaagggggtttagcattgttccctgagaaaccagacattcagtatctt
gctgacagcaagctaaatgacattgcagctactgatgcagacctcttcttcctatttgac
aacagaaaagacacctatgaacctcagatctctctgcggcctcatcccgaaagcatcaac
tacatccttcaggatccaaagaaaaccctctctttcttccaactccgcaaggtgtggggt
caagtctggcattcgatccagaagctgaatcgcgactttaaccaacttcagcatggtcag
cgagcagccatgaggaacttgctgcggcataacagcacgctttccaagatgaagaactcc
atggcttccctgtcccagcagctgaaggcaaagctggacttcttcaaaaccagcatccag
attgacttggagaaatacaatgagcaaactgagtttggaatcacctctgagaaattgcta
cttgcctggaaggaaatggagcaggatgtagagctctgtgggcaagaggaggaagttgag
gagctggtgaagaagactatggctctgcagacagagattgtagacctgcagaggatccca
cagggccgcaagcaagggagctccttggatgatctagaggagcaagccaaggacctatac
cggagactgagggaaaagccgagagatcagaggactagtggagactgccaggacgtagta
cggctgctgttgcaggccatccagatgtttgaaaagaaagtccgccttctttatgtgcag
ctcagcaacacagttgtgtgcaaacaaaaggcactgaaattgtttcctaaagtggacgag
gtgatgcatttgatgaatgaagatgagaaaaaggttatcggtctccaggagaaacggcag
aaagaactgtggaacttgctgaaaattgcctgtagtaaggtgcgtggtcctgtcagtggc
agcccagacagcatgaatatatcacgacttagtaatccgggtcagctgtccttgcagagc
tcagcccccaatggcaatttacaagaacccgtgcttaaaagtgaggtgctcttgatggaa
tcgcagagcctctgcagccagctagagaacgtgatgcttgacacaatgaaggatcaagac
cacagttttatggctttggactggagttggctgaaacttcaagtggaagaacgagagaac
ccagaacaaactcagatgtga

DBGET integrated database retrieval system