KEGG   Gekko japonicus: 107107878Help
Entry
107107878         CDS       T04299                                 

Gene name
OXSM
Definition
(RefSeq) 3-oxoacyl-ACP synthase, mitochondrial
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
gja  Gekko japonicus
Pathway
gja00061  Fatty acid biosynthesis
gja00780  Biotin metabolism
gja01100  Metabolic pathways
gja01212  Fatty acid metabolism
Module
gja_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107107878 (OXSM)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107107878 (OXSM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gja01004]
    107107878 (OXSM)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     107107878 (OXSM)
Lipid biosynthesis proteins [BR:gja01004]
 Fatty acid synthase
  Component type
   107107878 (OXSM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-GeneID: 107107878
NCBI-ProteinID: XP_015263725
LinkDB All DBs
Position
Un
AA seq 461 aa AA seqDB search
MRLQCLRDLFRMGRLNVRSSQAHHHLRIIKHMSTSVVSQARRRVVITGIGLVSPLGVGTQ
FVWNNLLQGNCGIVALEGEEYSSVPCKVAACVPDGVGEGQFLAENFVSKAESKAMSAATV
MAIGAADLALKDSGWYPQSELDHLSTGVAIGMGMVPLEEISNTALMFKTKGYNKVSPFFV
PKILINMAAGHVSIKYHLKGPNHAVSTACTTGAHAVGDAFRFVAYGDADVMLAGGTEACI
NPLSLAGFARARALSTSFNSSPKLSCRPFHSQRDGFVMGEGAAVLVLEEYEHAVQRGAKV
YAEILGYGLSGDACHITAPDPDGDGAFRCMAAALKDSGICPEDVAYINAHATSTPLGDAA
ENQAIKRLFKEHAYSLAVSSTKGATGHLLGAAGAIEAAFTALVCNHKVLPPTLNLDQTEP
PFDLNYVPLVPQEWKSATRLIGLTNSFGFGGTNATLCLASI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctccagtgcttgagagatttatttagaatgggacgcctcaatgttcgaagttcc
caagcacatcaccatttaagaatcattaagcacatgagtactagtgtggtctctcaagcc
cgaaggagagtggttatcacaggtataggactggtatctcctctcggtgttggaactcag
tttgtgtggaacaaccttctccaagggaattgtgggattgttgctcttgagggagaggaa
tattccagtgttccatgtaaagtggctgcttgtgttccagacggagttggtgaaggtcag
ttcctcgcagaaaacttcgtgtcaaaagcggagagcaaagccatgtccgctgccaccgtc
atggccataggtgctgccgatctagcattaaaagactctggctggtacccacagtctgaa
ctggaccatttaagtactggtgtggcaataggaatgggaatggttcccctggaagagatt
tccaatacagccttgatgttcaagacaaaggggtacaacaaagtcagcccattctttgtc
ccaaagatcttaatcaatatggctgcaggtcatgttagtattaaataccacttgaaaggt
cccaaccatgccgtatcgactgcttgtactacgggggcccatgctgttggagacgccttt
cgatttgtagcctatggggatgccgatgtgatgctggctggaggaacagaggcttgcatt
aacccattgtctctggctgggtttgctagagctcgggctctgagtacaagctttaactcg
agccccaaactgtcctgccggccatttcattcacagagagacggctttgtcatgggagaa
ggtgccgcagttttggttttggaagaatatgagcatgctgtacaaaggggagccaaagtg
tatgcagaaattttgggctatggactctcaggtgatgcttgtcacataacagcacctgat
ccagacggggatggtgccttcagatgtatggctgcagcattaaaggattctggaatttgc
cctgaagatgtagcatatatcaatgctcacgccacctccactccactaggagatgctgca
gagaatcaagctattaagagactctttaaggagcatgcatactctcttgcagtttcttcc
acaaagggagcaacagggcacctgttaggtgccgcaggggcgattgaggcagcatttaca
gctttggtttgtaaccataaagttttaccacctactctaaatctggatcagacagagcca
ccatttgacctcaactatgtcccacttgtacctcaagaatggaaaagtgcaacacgccta
attggtctcactaattcttttggctttggtggaactaatgcaacactgtgtctggctagt
atttag

DBGET integrated database retrieval system