KEGG   Gekko japonicus: 107108500Help
Entry
107108500         CDS       T04299                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107108500 (HDAC8)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107108500 (HDAC8)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     107108500 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 107108500
NCBI-ProteinID: XP_015264423
LinkDB All DBs
Position
Un
AA seq 346 aa AA seqDB search
MNGWLEASMVHSLIKSYSLLDYMRIVRPKVASMEEMASFHTDAYLQHLQKVSEEGDDDHP
ESVDYGLGYDCPATEGIFDYAAAVGGATITAAECLVDGKCKVAINWPGGWHHAKKDEASG
FCYLNDAVLGILRLRQKFDRVLYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGT
GDVTDVGLGKGRYYSVNVPIQDGVQDERYYQICETVLKEVYVAFSPEAVVLQLGADTIAG
DPMCSFNMTPVGVGWCLKYVLQWQLPTLILGGGGYHLANTARCWTYLTAVILGKTLSSEI
PDHEFFTDYGPDYVLEITPSCRPDRNDPQRIWDILSCVKGNLKHVV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatggctggcttgaggccagtatggtgcattccttgatcaaatcatactccctactt
gattacatgaggatagtccggcccaaggtggcctccatggaagagatggcaagcttccat
acggatgcctacctacagcatctgcagaaggtcagcgaggagggtgacgatgaccatcca
gaatctgtggattatggcctaggttatgactgccctgccacggaagggatctttgactat
gcagctgccgtgggaggagccaccattacagcagccgagtgtctggtggacggcaagtgc
aaggtagcaatcaactggcctggagggtggcatcatgccaagaaagatgaagcttctggc
ttctgttacttgaatgatgctgttctgggcatcctacggctgcggcagaaatttgaccgt
gtcctctatgtggacctggatttgcatcatggggatggtgttgaagatgctttcagtttc
acctccaaagtcatgacggtctctctgcacaaattttcaccgggatttttcccaggaaca
ggagacgtgactgatgtgggcctggggaaagggcgctattacagtgtcaatgtgccaatc
caggatggtgtccaagatgagagatactatcagatctgtgagacagtgctgaaggaggtc
tacgtggcatttagccctgaagctgtggtcctacagttgggagctgatactattgctggt
gaccccatgtgctcatttaacatgacccctgtgggtgttggctggtgcttgaagtacgtg
ctgcagtggcagctgccgaccctcattctgggaggaggcggataccatctggccaacact
gctcgctgctggacgtatttgactgcggtcattctagggaaaacgctgtcttctgagatc
ccagatcatgagttcttcacagattatggcccagattatgtgctggaaatcacaccaagc
tgcaggccggaccgcaatgatcctcagagaatctgggacatactcagctgcgtaaaaggg
aatctgaagcatgtggtttag

DBGET integrated database retrieval system