KEGG   Gekko japonicus: 107108561Help
Entry
107108561         CDS       T04299                                 

Gene name
OGT
Definition
(RefSeq) O-linked N-acetylglucosamine (GlcNAc) transferase
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107108561 (OGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_17 TPR_8 TPR_12 TPR_14 TPR_16 TPR_19 TPR_7 TPR_10 TPR_9 TPR_6 NARP1 TPR_MalT TPR_15 FAT MIT TPR_21 Wzy_C_2 TPR_3 SNAP EST1_DNA_bind BTAD ANAPC3 Fis1_TPR_C Tcf25
Motif
Other DBs
NCBI-GeneID: 107108561
NCBI-ProteinID: XP_015264494
LinkDB All DBs
Position
Un
AA seq 1045 aa AA seqDB search
MAASVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYKRAIELQPHFPDAYCNLA
NALKEKGSVAEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHNFRKAIAERHGNLCLDKINVLHK
PPYEHPKDLKASEGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILINMNGYTKGARNELFALRPAPIQA
MWLGYPGTSGALFMDYIITDKETSPTDVAEQYSEKLAYMPNTFFIGDHANMFPHLKKKAV
IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKLVKMKCPDGGDNADSNAGLSMPVIPMNT
IAEAVIDMINRGQIQITINGFNISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDS
VVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRII
FSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLT
CLGCPELIAKSRQEYEDVAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTIELERLYL
QMWDHNAAGNKPDHIINPIEGGESA
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctctgtggggaacgtagccgacagcacagaaccaacgaaacgtatgctttcc
ttccaagggctagcagagttggctcaccgggaatatcaagcaggagacttcgaagctgct
gagagacactgcatgcagctttggcgacaagagcctgacaacactggtgtgcttttgttg
ctctcgtctattcacttccagtgtcgcaggctggacaggtctgctcacttcagcactttg
gcaatcaagcagaatccacttctggctgaagcctactccaatctgggaaatgtgtacaag
gaacgtgggcaactgcaggaggcaattgagcactatcgacatgccctgcgcctcaagcca
gactttattgatggatacattaatctggcagctgctttggtagctgcaggtgatatggaa
ggggcagtgcaggcatatgtttctgccctgcagtacaatcctgacttgtactgtgttcgt
agtgacctggggaacctgctcaaagccctgggtcgcttggaagaagccaaggcctgttat
ttgaaggcaattgagactcaaccaaattttgcagtagcgtggagcaatcttggctgtgtg
ttcaatgcacaaggagaaatctggcttgccattcatcattttgaaaaggcggtgactctt
gacccaaacttcttggatgcttatattaatctggggaatgttttgaaagaagcacgtata
tttgacagagctgtagctgcctatctacgggccctgagtctgagtccaaaccatgcagtt
gtgcatggcaacctggcctgcgtctattatgagcagggcttgattgacttggcaattgat
acctacaagcgtgctattgaactgcagccgcacttccctgatgcttactgcaacctggcc
aatgcgctcaaggagaaaggcagtgttgctgaggcggaggaatgttacaacacagctctt
cgtctgtgccccactcatgcagattctcttaataatctggcaaatattaaacgggagcag
ggaaacattgaggaagctgttcggctgtatcgtaaagcacttgaggtgttccctgagttt
gcagctgcccattccaatcttgcaagtgttttgcagcagcaggggaagctacaggaggca
ctcatgcattacaaggaggctattagaatcagtcccacatttgctgatgcctattccaac
atgggaaacacactaaaggagatgcaggatgttcagggagctttgcaatgttacacacgg
gccattcagataaaccctgcctttgctgatgctcacagcaatctggcttccatccataag
gattcagggaacataccagaggccattgcttcataccgcactgccctgaaactgaaacct
gacttccctgatgcctattgcaatttggcacattgcttgcagatagtttgtgattggact
gactatgatgaaaggatgaagaagctggtcagcatagttgctgatcagttggaaaagaac
aggcttccttctgtccatcctcatcacagtatgctatatccgttgtcccacaatttccgg
aaggctattgctgagagacatggaaacctatgcttggacaagatcaacgtccttcacaag
ccgccatatgagcatcccaaggacttgaaggctagcgaaggccgactgcgtgttggctat
gtaagctctgactttgggaatcatcccacttcccacctcatgcagtcaattccgggcatg
cacaaccctgacaaatttgaggttttctgctatgccctcagccctgatgatggcacaaac
ttccgggtaaaggtgatggctgaagcaaatcattttattgatctgtcccagattccatgc
aatggaaaggcagctgaccgcatccaccaggatggcatacacatcctcatcaacatgaat
ggttacaccaaaggagcccgcaatgaactgtttgccctaagaccagctccaatacaggct
atgtggttaggctatcctggaactagtggcgcattattcatggattacatcatcacagac
aaagaaacctcccctactgatgtggctgagcagtattctgaaaagctggcttacatgcca
aatacattcttcattggagatcatgccaacatgttcccacacttgaagaaaaaagccgtt
attgacttcaaatccaatgggcatatttatgacaacagaattgttttaaatggcattgat
ctgaaggcattccttgacagtcttcctgatgtaaaactagtgaagatgaaatgtcctgat
ggtggggacaatgccgacagcaacgctggactcagtatgcctgtcattcctatgaataca
attgcagaggcagtgattgacatgataaatcgtggacaaattcagataactatcaatgga
ttcaacattagcaatgggcttgcaactacccagatcaacaacaaagcagcaactggtgag
gaggttccacgcaccatcattgtcactacccgctcccagtatggattgcctgaagattct
gttgtttattgcaactttaatcagctttataaaattgacccttccacacttcagatgtgg
gccaatattttaaagcgtgtcccaaacagtgtattgtggctgctgcgtttcccagctgta
ggagaaccaaatattcaacagtatgcacagaacatgggccttccacaaaaccgcatcatc
ttctctccagtagcccccaaagaggaacatgtgaggaggggccaacttgctgatgtctgt
ctagatacacccctttgtaacggccacaccacagggatggatgtgctctgggctgggacc
cctatggttaccatgccaggagagactcttgcatcacgtgttgcagcctcacagcttact
tgccttggctgtccggaactaattgcaaaaagtagacaggaatacgaagatgttgctgtt
aagctgggaacagatctagaatacctgaagaaaatacgtggcaaggtctggaagcagcga
atatccagtcccctgttcaacacaaagcagtacacaattgaactggagcggctttatctt
cagatgtgggatcacaatgcagctggcaacaaaccagaccacatcatcaatcccatagag
ggtggtgaatcagcataa

KEGG   Gekko japonicus: 107121813Help
Entry
107121813         CDS       T04299                                 

Gene name
EOGT
Definition
(RefSeq) EGF domain specific O-linked N-acetylglucosamine transferase
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107121813 (EOGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107121813 (EOGT)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     107121813 (EOGT)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   107121813 (EOGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563 GDNF
Motif
Other DBs
NCBI-GeneID: 107121813
NCBI-ProteinID: XP_015280295
LinkDB All DBs
Position
Un
AA seq 528 aa AA seqDB search
MLMLLAFGVLLREIWASIHDENLADASSIPEAPLFSYENINVPEEHIPYFLHNNQHIATA
CKQDPHCPYKKYLKKLKSCWGYEKSCKPEKRFGYPTCDYAEAGWASTIEEAQHLFWKQAD
FGYVKERIDEVKTHCRPKAMGDSSLECSRYLQYCRAKNLYIDLRSPERTHDRFNEDFFQK
GQIGGHCNLDVKAFLAEGQRKSPLQSWFAELQMYTELNARPTEDGSCDVVIDKPTYFMKF
DAGVNMYHHFCDFVNLYITQHVNNSFSTDVNIVMWDTSSYGYGDLFSETWTAFTDYEIMH
LKSYDSKRVCFKEAVFALLPRMRYGLFYNTPLISGCHGTGLFRAFSQHVLHRLNVTQDGP
KDGKIRVTILARSTAYRNILNQNVLASALKTLSLFDVQIVNYKYKELEFTKQLKITHNSD
IFIGMHGAGLTHLLFLPDWAVIFELYNCEDEHCYLDLARLRGVHYMTWQRKDKVFPQDQG
HHPTLGKHPKFTNYSFDVEEFVRLVLLAADRVSQHSKWPFRRKQRDEF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgctgcttgcatttggagtgctacttcgggaaatctgggccagtattcatgat
gaaaatcttgctgatgccagcagtattccggaagcgccattgtttagctatgaaaacatc
aacgtgccagaagagcacatcccctactttttacataacaaccagcacattgccacagcc
tgtaagcaggatcctcattgcccatataaaaaatacttgaagaaattgaaatcatgttgg
ggctatgagaaatcctgtaaaccagaaaaaaggtttggatatccaacatgtgattatgcg
gaggcagggtgggctagtactatcgaggaggctcagcatttgttctggaagcaagctgat
tttggttatgttaaagagaggatagatgaagtgaagactcactgcagacctaaggcaatg
ggagattcttcacttgaatgttcacgttatctccaatactgcagagcaaagaatttgtac
attgatttaagaagcccggagaggacccatgacagatttaatgaagactttttccagaag
gggcaaattggaggtcattgtaacttggatgttaaagctttccttgctgaaggccagcgg
aaaagtcctctgcaatcttggtttgctgagctccagatgtatacagaactgaatgctaga
cctacggaagacggtagctgcgatgttgttattgacaagccaacttatttcatgaagttt
gatgcaggtgttaatatgtaccaccatttctgtgactttgtcaatctttacatcactcag
catgttaacaactctttcagcacagatgtcaacattgtcatgtgggatactagttcctat
ggctatggagacttgttcagtgaaacttggacggcatttacagactatgaaataatgcat
ttgaaatcgtatgattcaaaaagagtatgcttcaaagaagcagtttttgccttactgcct
cgcatgaggtatggcttattttataacactccactgatctctggctgccacggtacagga
ttatttagagccttttcccagcatgtcttacacagattaaatgtcacgcaagatggacct
aaggatggaaaaattagagttacaatacttgcccgaagtacagcatacaggaatatacta
aaccaaaatgtgcttgccagtgctttgaaaacattgtcgttatttgacgtccagatagtc
aattacaagtacaaggagctggagtttacaaagcagctgaaaattacacacaattctgat
atattcattggaatgcatggagcaggacttactcatcttctctttctgccagactgggct
gtcatctttgaactgtacaactgtgaagatgaacactgctatttagatctggcaagactg
agaggtgtccattacatgacctggcaaaggaaggacaaagtattcccccaagatcagggg
catcatccaacacttggaaaacacccgaagtttacaaattactcgtttgacgtggaagaa
tttgtccgcttggtgcttctggcggctgatcgtgtgtcacaacattccaaatggccgttt
aggagaaaacaacgtgatgaattctag

DBGET integrated database retrieval system