KEGG   Gekko japonicus: 107108578Help
Entry
107108578         CDS       T04299                                 

Gene name
GATB
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gja  Gekko japonicus
Pathway
gja00970  Aminoacyl-tRNA biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107108578 (GATB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gja03029]
    107108578 (GATB)
Enzymes [BR:gja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     107108578 (GATB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     107108578 (GATB)
Mitochondrial biogenesis [BR:gja03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107108578 (GATB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 107108578
NCBI-ProteinID: XP_015264522
LinkDB All DBs
Position
Un
AA seq 556 aa AA seqDB search
MAASAIGCSRRWFRAGNFNFGNVAEPRCWKSLVLASTFFRSASKTAGKQNRDVPWAAVVG
LEIHAQISSNSKLFSGSQVQFAAPPNSLVSFFDASLPGTLPVLNRRCVEAAVTTGLALNC
TINKKSLFDRKHYFYADLQAGYQITQHRLPIAVNGSLPYSLCTGKNQNELVSKTVRVKQI
QLEQDSGKSLHDDTGHQTLIDLNRAGVGLMEVVMEPDMCCGKEAAAAVRELQLILQALGS
SQANMAEGQLRVDANISVHHPGQPYGVRTEVKNINSARFLAKAIDYEIQRQINELESGGT
ILNETRAFDYKLGCTIAMRDKEGKQDYRFMPEPNLPPLILYDAKSLPTHTSHLQVVNIDQ
LQEQLPDLPSVKRAKLVERYGIQPQHSFTLLNEDGLIEFFETVIAATQMNPKKVIGWILK
DVLGYLKQYNVMVEESPISPLLLAELLNLLESGMISSSAAKQVLEIMWNGEGKSPTLIVK
EKKLELIRDQNELEHICQAVMDGHQKEVEAIKKGNKKVLNKLIGEVQRETRGRSDPVSVK
QILEKQLLLQPTKKNP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgcgataggttgtagtcgccgttggtttcgggctgggaatttcaacttt
gggaatgtcgccgagccgcgctgctggaaaagtttggtgcttgctagtacattctttaga
agcgcaagcaagactgcagggaaacagaaccgtgatgttccctgggcagctgtggtgggc
ctggaaattcatgcacagatctcctccaactcaaagctcttctctggttcacaagtccag
tttgcagcaccacctaattctttagtatcattctttgatgcttctctaccaggaacccta
ccagttctcaacaggagatgcgttgaagcagcagtgacaaccggccttgctctgaactgc
accataaacaagaagtccttgtttgacaggaaacactatttctatgcagatctgcaggct
ggctaccagatcactcagcacaggcttcccattgctgtgaatgggagtctgccatacagc
ctgtgcacagggaagaaccaaaatgaactggtaagcaagactgtgagagtcaagcagata
cagttggagcaagacagtggaaagagtcttcacgatgacacagggcaccagacacttatt
gacttgaacagagcaggagttggactcatggaggttgtcatggagccggatatgtgctgt
gggaaagaagccgccgctgcagtgagagagcttcagcttatccttcaggctcttgggagc
agccaagcaaacatggcagagggccaactgagagtcgatgccaatatatctgtacatcat
cctggacagccgtatggagtgaggactgaagtaaagaatatcaacagtgcccgctttctt
gccaaggcaatagattatgaaatacaaagacaaattaatgagctggagagtggaggaaca
atcctgaacgaaactagggcctttgattacaagcttgggtgcaccatagcaatgagagat
aaagaaggaaaacaggactaccggttcatgccagaaccaaaccttcctcctttgattctg
tatgatgctaaatctttgcccactcacacaagccatctgcaagtggtgaatattgatcag
cttcaggaacagcttcctgacctccccagtgtgaagagagcaaagctggtggaacgttac
gggattcagccacagcacagtttcaccctattgaatgaagatggcctaattgaattcttt
gaaactgtgatagcggctacacagatgaatcctaaaaaggttattggctggattctgaaa
gatgtacttggctatttgaaacagtataacgtaatggtagaggaaagtccaatcagtcct
cttcttttggctgaacttctgaaccttctagaaagtggaatgatttcctcttcagcagcc
aaacaagtgttggaaataatgtggaacggggaggggaaatctccgactctgattgtcaaa
gaaaagaaacttgaactgattcgagatcagaatgagcttgagcacatctgtcaggctgtg
atggatggccatcagaaagaggtggaagcgattaaaaagggaaacaaaaaagttctgaat
aagctgattggagaggtccaaagagaaaccagaggaagatctgacccagtctctgtgaaa
caaatattggagaaacagctattgttgcagcccaccaaaaaaaacccttag

DBGET integrated database retrieval system