KEGG   Gekko japonicus: 107108795
Entry
107108795         CDS       T04299                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04012  ErbB signaling pathway
gja04068  FoxO signaling pathway
gja04150  mTOR signaling pathway
gja04270  Vascular smooth muscle contraction
gja04510  Focal adhesion
gja04810  Regulation of actin cytoskeleton
gja04910  Insulin signaling pathway
gja04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107108795 (BRAF)
   04012 ErbB signaling pathway
    107108795 (BRAF)
   04068 FoxO signaling pathway
    107108795 (BRAF)
   04150 mTOR signaling pathway
    107108795 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107108795 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107108795 (BRAF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107108795 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    107108795 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107108795 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107108795 (BRAF)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107108795 (BRAF)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107108795 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH FliD_N Kdo
Other DBs
NCBI-GeneID: 107108795
NCBI-ProteinID: XP_015264803
LinkDB
Position
Un
AA seq 767 aa
MAALSSGGSAEGASLFNGDMEPEPPPPGACYAGGGGSAGGDPAVPEEVWNIKQMIKLTQE
HIEALLEKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVSSSASTDT
VTSSSSSSLSVAPSSLSVYQNPTDLSRNNPKSPQKPTVRVFLPNKQRTVVPARCGVTVRD
SLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVR
KTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHP
IPQEETSLGETTLASGSYLSVGPSDSPGPAILPSPSPSKSIPIPQPFRPADEDHRNQFGQ
RDRSSSAPNVHINTIEPVNIDEFIRDQGLRGEGGSTAGLSATPPASLPGSLTSVKALQKS
PGPQRERKSSSSSEDRTRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGD
VAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYH
HLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLAT
VKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNI
NNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERHLFPQILASIELLAR
SLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcagcggcggcagcgccgagggggcctcgctcttcaacggggacatg
gagcccgagccgcctccgccgggggcctgctacgcggggggcggcggcagcgccggagga
gaccccgccgtccctgaggaggtgtggaacatcaaacagatgattaagttaacacaagag
cacatagaggcccttctggagaagtttggaggagagcataatccaccatctatatatttg
gaggcctatgaggaatacaccagcaagttagatgcactgcagcagcgggagcagcaatta
ctagaatccatggggaatggaactgatttctctgtctccagttctgcttcaacagatacc
gttacatcatcgtcatcctctagcctctcggtagccccatcatccctctcagtttatcag
aaccctacagatttgtcacggaataaccctaagtctccacagaaacctacagttagagtc
ttcctgcccaataaacagaggaccgtggttccagcaagatgcggggtaacagtccgggat
agcttaaagaaagctttgatgatgcgaggtcttattccagagtgctgtgctgtttaccga
atacaagatggggagaagaaacctatcggttgggatacagacatttcctggcttactgga
gaggaattacatgtggaagtcttggagaatgtgcctcttacaacacataactttgtacga
aagacattctttactttagcattctgtgacttctgtcgaaagctgcttttccagggattc
cgctgtcagacttgtggatataaatttcaccagcgttgtagtacagaggtgccattgatg
tgtgtgaattatgatcaacttgacttgctgtttgtctccaagttctttgagcaccaccca
ataccgcaggaggaaacctccttaggagagaccacgctggcgtctggatcatacctatca
gtgggcccctcagattctcctggcccagcaatcctccctagtccatctccttcgaaatcc
attccgataccccagccattccgtccagcagacgaagaccatcggaatcagtttggtcaa
cgagatcgctcctcatccgcccccaacgtgcacatcaacacgatagaacctgtcaacatt
gatgaattcattagagatcaagggttgcgaggagagggaggttcaaccgcaggtctgtcg
gctacacctcctgcttccctacctgggtccctcaccagtgtgaaagcattacagaaatcc
ccaggccctcagcgagagaggaaatcctcctcatcttcagaagaccggactcgaatgaaa
acccttggtcgacgagactcgagtgatgactgggagataccagatggccagatcacagtt
ggacaaaggataggctccgggtcttttggaacagtctataaaggaaagtggcatggtgat
gtggcagtgaaaatgttgaatgttacagcccccacccctcagcaattacaggcctttaaa
aatgaagtaggagtgctcaggaaaacacggcatgtgaatatattacttttcatgggttat
tccactaagccgcagttggctatagttacgcagtggtgcgagggttccagcctttaccac
cacctgcacatcatcgagaccaaatttgagatgatcaagctgatcgacattgcacggcaa
acagcgcagggcatggattacttgcacgccaagtccatcatccacagagacctcaagagt
aataatatatttcttcatgaagacctcacagtaaaaataggtgactttggcctagctaca
gtgaagtcacggtggagtgggtctcatcagtttgaacagttgtctggatcaattctctgg
atggcaccagaggtgatacggatgcaggataagaacccatatagctttcagtcagatgta
tatgcatttgggattgttttgtatgagctgatgactgggcagttaccctattcaaacatc
aacaacagggaccagatcattttcatggtggggcgaggatacctctctccagacctcagc
aaagtgcgcagcaactgtcccaaagctatgaagaggctcatggcagagtgcttgaaaaag
aagcgggacgaacggcatctcttcccacagatccttgcctccattgagcttctggcccgg
tcgttgccaaaaattcaccgcagtgcatctgagccctccttgaaccgggctggattccag
acagaggattttagtctgtatgcttgcgcttctccaaaaacacccattcaggcaggggga
tatggtgcgtttcctgtacactga

DBGET integrated database retrieval system