KEGG   Gekko japonicus: 107109055Help
Entry
107109055         CDS       T04299                                 

Gene name
POMT1
Definition
(RefSeq) protein O-mannosyltransferase 1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
gja00515  Mannose type O-glycan biosynthesis
gja01100  Metabolic pathways
Module
gja_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    107109055 (POMT1)
   00514 Other types of O-glycan biosynthesis
    107109055 (POMT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107109055 (POMT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     107109055 (POMT1)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Man type
   107109055 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR
Motif
Other DBs
NCBI-GeneID: 107109055
NCBI-ProteinID: XP_015265115
LinkDB All DBs
Position
Un
AA seq 673 aa AA seqDB search
MLGFLKHPVVLSVEININLLLLAVAGLMSRLWALSYPRAVVFDEVYYGQFLSLYMKQIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSPNVPIWTLRLLPAVAGALCVPLAY
QILVELRFSHLVAHGAALLILLENSLITQSRLMLLESVLIFFILLGVLSYLKFYNLQRQS
PFSARWWFWLCLTGVSCACAVGVKYMGLFTYILLLTXXGMHSWQLFGDRSLPNVSLLCHL
LARGLALVVIPVATYLLFFYVHLTLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNILGKPMPCWLHSHKNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
TQQLVVSNPPRPVRHGNIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRDSDGDIWKTILSEVRFVHVNTSAVLKLSGASLPEWGYRQLEIIGEKISKGY
HQSMLWNVEEHRYGKKLHGHVKLPDTKPDPRSVKAQIHLLGNVVTWMSANIATLAYVALF
FWYLLRRRRHIHDIPEDAWWQWVSAGGLCVGGWAANYLPFFLMEKALLXYHYLPAVTFQI
LLVPVVLQHMSDHLCRSKLSKSMHSAFVVAWFSSVYLTYHTFQPLTYGEPPLSKAELQNL
RWKDSWDILIRKH
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcttcctgaagcacccagttgtcctttcagtggaaataaacatcaacctgttg
cttttggctgttgctgggctaatgagccggctgtgggcgctgtcctaccccagagctgta
gttttcgacgaagtctactacggacagttcctctctctgtatatgaagcagatcttcttt
gtggacgacagcggccccccgtttggtcacatgcttttggccttaggaggttacttaggt
ggatttgatgggaattttttatggaacagaatcggtgctgaatatagtcccaacgtgccc
atttggaccctgcggctgctgcctgcggtcgcgggtgccctgtgtgtccctctggcatac
cagatcttggtggagctgcgtttttctcacctcgttgcgcacggagctgctctgctaatt
ctgttggagaactccctgatcactcagtccaggctgatgctgctggagtccgtcttgatc
tttttcatcttgctgggcgttctgtcctacttgaagttctataacttgcagaggcagagc
cccttttcggcaagatggtggttttggctttgcttaacaggagtttcctgtgcctgcgca
gttggggtgaaatacatgggcctctttacctatatcctgcttttgacnnnnnnaggaatg
cactcgtggcaactgttcggcgatcgaagcttaccgaatgtttctctactgtgtcacttg
ctggccagaggacttgcccttgtggtcatccccgtcgccacgtacctgctgttcttctac
gtccacttgacgttgctgtatcgctccgggccccacgaccagatcatgaccagcgccttc
caagcaagcttagagggtgggctggctcggattactcaaggacagcctctggaagtggcc
tacggctcccagatcaccttgcggaacatcttgggcaagcctatgccctgctggctgcat
tcgcacaagaacacctatcccatcaggtatgaaaatggtcgtggcagctcccaccagcag
caggtgacctgctaccctttcaaggacgtgaataactggtggattgtgaaagatcctggc
acgcagcagctggtggtcagtaacccaccacgtcctgtgcgccacgggaatatcgttcag
ctggtccacgggatcacaacgcgctacctgaacacgcacgacgtcgccgccccgctgagc
ccccactcccaagaagtctcctgttacatcgattacaacatctccatgccggcccagaac
ctctggagagtggaaatcgtgaaccgggactcggatggggacatttggaagacgatcctg
tctgaagtacggtttgtccacgtgaacacctcggcagtgctgaagctcagtggcgcctcc
ctgcccgagtggggctatcggcagctggagatcattggggagaagatttccaagggctac
caccagagcatgttgtggaacgtagaggagcacagatatgggaaaaagctccacggacac
gtgaagctgcctgacaccaaaccagaccctcggtccgtcaaagcccagatccacctgctt
ggaaacgtcgtcacctggatgtcggccaacatagcaactcttgcgtatgtggccttgttc
ttctggtacctgctgcggcggcggcggcatatccacgacatccctgaagatgcctggtgg
cagtgggtctcggcaggagggctctgcgtggggggctgggcagcgaactacctccccttc
ttcctgatggagaaagcgctcctcnnctaccactacctgccggctgtcaccttccagata
ctccttgtccccgtcgtcctgcagcacatgagtgatcacctttgcagatcaaagctctcc
aagagtatgcacagtgcttttgtggtggcctggttctcctccgtctacctgacctaccac
acgttccaaccactcacctacggcgagcctcctctttccaaagctgagctccagaacctg
cgctggaaggacagctgggacatcctgatccggaaacactag

KEGG   Gekko japonicus: 107116470Help
Entry
107116470         CDS       T04299                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyltransferase 2
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
gja  Gekko japonicus
Pathway
gja00514  Other types of O-glycan biosynthesis
gja00515  Mannose type O-glycan biosynthesis
gja01100  Metabolic pathways
Module
gja_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    107116470 (POMT2)
   00514 Other types of O-glycan biosynthesis
    107116470 (POMT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107116470 (POMT2)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     107116470 (POMT2)
Glycosyltransferases [BR:gja01003]
 O-Glycan biosynthesis
  O-linked Man type
   107116470 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR
Motif
Other DBs
NCBI-GeneID: 107116470
NCBI-ProteinID: XP_015273849
LinkDB All DBs
Position
Un
AA seq 730 aa AA seqDB search
MPLAVNKTCQAVLGLQQRRTLRLASSPASASSVPRSSVWFWTQLGLVTFLSFATRFYRLQ
EPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYNGTFPFQKPGDKYE
EHNYIGMRGFCAFLGSCLIPFSYLTVLELSKSLPAAMLTAAILIFDTGCITLSQYILLDP
ILMFFLMGAVFSMVKYNSCANRPFSAPWWFWLCLTGVNLAGAMGVKFVGLFVVLLVGLNT
IYNLWELLGDLSLSLVTLGKHFMARVLCLILLPLALYTAQFAVHFAVLNRSGPGDGFFSS
GFQSRLIGNNLHNVSVPEYLAYGSVVTVKNLRMAGGYLHSHWHLYPEGVGARQQQVTAYL
HKDLNNLWIIKKYNLNTDYLDPSLPVEFVKHGDIIRLEHKETSRNLHSHQHEAPLTRKHL
QVTGYGINGTGDSNDFWRIEVVGRKAGKHIKVLRSQIRLIHLATGCILGSTGKTLPKWGW
EQVEVTCTPYQKESPNSLWNVEDHINPRLRNISLDVLKPSFPEILLESHMVMIRGNSGLK
PKENEVTSKPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNLATIGLYIIMATFISV
AIKRGTHLTAEHQELSRVLLHGGGLIMLGWLLHYLPFFMMGRVLYFHHYFPAMLFSSMLT
GITWDVFLKFCAGMLSASIQVYNCGIVLLILLTMYSFYLFHPLSYGMIGPLASDPNSPMA
GLRWLETWEF
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggcagtgaacaaaacctgccaggccgtgttgggcctgcagcaacggagaacc
ctcaggctggcaagtagccccgcgtcggcttcctccgtaccccggagttctgtgtggttc
tggacccagctgggcctggtcactttcctaagcttcgctacccgcttctatcgcctgcag
gagccgccacacatctgttgggatgaaacacattttggaaagatgggaagctattacatt
aatcggacttttttctttgatgtccatccacctctggggaagatgctaataggactggct
ggctacctgagtggttacaatgggacgtttcctttccagaagccaggggacaaatatgaa
gaacacaattatataggaatgagagggttctgtgcatttcttggttcgtgcctgattccc
ttttcttacctcacggtgctggagttgtccaagtcactgcctgcagcaatgctcacggct
gcaatcctgatttttgacacggggtgcattactctttcacagtacattctgcttgatcca
attctgatgttcttcctcatgggagctgtattcagtatggtcaagtataattcctgtgca
aacaggcccttttctgccccctggtggttctggctgtgcttgactggggtaaaccttgca
ggtgcaatgggggtgaaatttgttggtctttttgtggtcctgctggttggattgaacaca
atatataacctttgggagctgttaggagacctcagtctctcactggtcactctggggaag
cacttcatggctcgagtactctgcctcattctgctgcctctcgccctctacacggcccag
tttgcagttcattttgcagtgttaaacagaagtgggcctggtgatggctttttcagctcc
ggatttcagtcccggctgattgggaacaaccttcataatgtctctgttccagagtatcta
gcatatggctctgtggtaacagtgaagaaccttcgtatggctggtggatacctgcactcg
cactggcatctgtatcccgagggagtgggagcacggcagcagcaggtcactgcctattta
cacaaagacttgaataatttatggattataaagaaatacaacttgaacacagattattta
gacccttctttgcctgtggagtttgtgaagcatggagatattatccgtctggaacacaaa
gagacttctagaaacttgcacagtcaccagcatgaggccccgttgacaagaaagcacctt
caggtcactgggtatggcataaatgggactggagattccaatgatttctggcgaattgaa
gttgtgggaaggaaagctgggaaacatatcaaggtcctacgtagtcaaattcgactgatt
catctggctacaggctgtattttgggttcaactggaaagacactgccaaaatggggctgg
gagcaggtggaagtcacttgtacgccataccagaaggagtctcctaattccctctggaat
gttgaagaccacatcaatcccaggttgcgcaacatcagtctggatgttctgaaaccctcc
tttccagagattctgctggagtctcatatggttatgatccgaggaaacagtggcctcaaa
ccaaaggagaatgaagtaacatccaagccctggcactggcccatcaattaccagggcctg
cgtttttctggagtgaatgagacagattatagggtttatttgctgggaaacccggtgatc
tggtggctgaatctagctactattggcttatatatcataatggcaacattcatatctgtg
gccatcaagagaggaactcacctgacagctgagcaccaagagctttcccgagtcctgttg
catggtggaggactgatcatgctgggatggcttctccattatcttcctttcttcatgatg
gggagagtactatattttcatcattacttccctgccatgctcttctcctccatgttgaca
gggattacatgggatgtattcctgaaattctgtgctgggatgctgtcagccagcatccag
gtttataattgcgggatagtgctgttgattctgctcactatgtacagcttctacctcttc
catccgctctcttacgggatgataggacctctggcttctgatcccaacagcccaatggca
ggacttaggtggctggaaacatgggagttctag

DBGET integrated database retrieval system