KEGG   Gekko japonicus: 107109696
Entry
107109696         CDS       T04299                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
gja  Gekko japonicus
Pathway
gja04012  ErbB signaling pathway
gja04137  Mitophagy - animal
gja04144  Endocytosis
gja04370  VEGF signaling pathway
gja04510  Focal adhesion
gja04520  Adherens junction
gja04530  Tight junction
gja04540  Gap junction
gja04625  C-type lectin receptor signaling pathway
gja04810  Regulation of actin cytoskeleton
gja04912  GnRH signaling pathway
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107109696 (SRC)
   04370 VEGF signaling pathway
    107109696 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107109696 (SRC)
   04137 Mitophagy - animal
    107109696 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107109696 (SRC)
   04520 Adherens junction
    107109696 (SRC)
   04530 Tight junction
    107109696 (SRC)
   04540 Gap junction
    107109696 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107109696 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107109696 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107109696 (SRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107109696 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107109696 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107109696 (SRC)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107109696 (SRC)
Protein kinases [BR:gja01001]
 Non-receptor tyrosine kinases
  SRC family
   107109696 (SRC)
Membrane trafficking [BR:gja04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107109696 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    107109696 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107109696 (SRC)
  Macropinocytosis
   Kinases
    107109696 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 107109696
NCBI-ProteinID: XP_015265859
LinkDB
Position
Un
AA seq 532 aa
MGSSKSKPKDLSQQRRSLESTENIHGGCSALQTPNKTTASEAHRTPSRLHGSTTPETKLF
GGSNTSSMVTSPQHRGGIPAGVTTFVALYDYESRTESDLSFKKGERLQILNNTEGDWWLA
HSLTTGQKGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLARESETTK
GAYCLSVSDFDNAKGLNVKHYKIRKLDNGGFYITSRTQFSSLQQLVAYYSKHADGLCHRL
TNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGT
MSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMCKGSLLDFLKGEMGKYLRLP
QLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQG
AKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLDQVERGYRM
PCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggggagcagtaagagtaaacccaaagacctcagtcagcagagacgcagcctggaatcc
acggagaatatccatgggggctgttctgcattacagactcccaacaagaccactgcctcg
gaggcccaccgaactcccagccgtttacatggcagcaccactccagaaacaaagctcttt
gggggctcgaatacatccagtatggtcacctctcctcagcaccgtgggggaatacctgct
ggtgtcaccacgtttgtggccctctatgattatgagtcccggacagaatcagatctgtca
ttcaagaaaggggaacgcctccaaatcctcaataacacggaaggagattggtggctggct
cattccctcaccactggtcagaaaggctacatccccagtaactatgtcgcaccctcagac
tccatccaggctgaagaatggtattttggcaagatcacccgccgagagtctgaacggcta
ctactcaatcctgagaatccccgagggaccttcctggccagggagagcgagacaacaaaa
ggtgcctactgcctctccgtctctgatttcgacaacgccaagggcctcaacgtcaaacac
tacaagatccgcaagttggataacggtggtttctacatcacctcccgcacgcagttcagc
agccttcagcagctggtagcctattattccaagcatgcagatggcctgtgccaccgtctc
accaatgtctgtccgactagcaagcctcagacgcaaggcctggcaaaggacgcctgggaa
atccctcgggagtcgctgcggttagaggtgaagcttgggcaaggctgttttggagaagtg
tggatgggcacctggaatggcaccactcgggtggcaatcaagactctgaagcccgggacg
atgtctcccgaagcatttctgcaggaggctcaggtcatgaagaaactccgccatgagaag
ctggtgcagctgtatgctgtggtttcagaggagcccatctacattgtaacggaatacatg
tgcaaagggagcctcctggatttcttgaaaggggagatgggcaagtatctgcggttgccc
cagctggtggacatggcggctcagattgcatctggcatggcatatgtggagaggatgaac
tacgttcaccgagatcttcgagctgccaacatccttgtgggtgaaaacctggtatgcaag
gtagctgactttggactggctcgactgattgaggacaatgaatacacagctaggcaaggt
gctaaattccccattaagtggactgccccggaagcggctctctacggccggttcaccatc
aagtcggacgtgtggtccttcgggatattgctgactgaattggccacaaagggacgggtg
ccatatccaggtatggtgaaccgagaagtcctcgaccaagtggagcgtggctaccgaatg
ccctgccctccagaatgcccagagtctttgcatgacctgatgtgccagtgctggagaaag
gatcctgaggagaggcctacctttgaatacctacaggctttcttggaggactacttcaca
tccacagagcctcagtatcagccgggcgagaacttgtag

DBGET integrated database retrieval system