KEGG   Gekko japonicus: 107110204Help
Entry
107110204         CDS       T04299                                 

Gene name
C1GALT1
Definition
(RefSeq) core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
gja  Gekko japonicus
Pathway
gja00512  Mucin type O-glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107110204 (C1GALT1)
   00514 Other types of O-glycan biosynthesis
    107110204 (C1GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107110204 (C1GALT1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     107110204 (C1GALT1)
Glycosyltransferases [BR:gja01003]
 Glycan extension
  Type 3 chain
   107110204 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 107110204
NCBI-ProteinID: XP_015266431
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MAVPKSLLNSLTFIFGSAIGFFLCYMLFSLILEEQVKTEPRILYNNPHVRHSDDDESDLL
NGQMNFNADAGQHKDEDKNIAEELHQKVKILCWVMTGPQNLEKKARHVKATWAQRCNKML
FMSSEENKDFPTVGLETKEGRDQLYWKTIKAFQYVHDHHLGEADWFMKADDDTYVALDNL
RWLLSKYSPEEAIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVNAFKTNKCSHSSSIE
DLALGKCMEAIGVKAGDSRDTSGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPIEGPG
CCSDLAVSFHYVDAATMYQLEYLIYHLRPYGYQFRYNPDFHKNLKTQNLSDTAKDDAEDT
AKDDAEPKVEGPLKGSK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccgttcctaaatctttgctgaattccctgacctttatctttggatcagcaattgga
tttttcttatgttacatgttgttcagcttaatactggaggaacaggttaagactgagcct
cgtattctttacaacaatccccatgtccgtcactcagatgatgatgaaagtgatctattg
aatggacagatgaatttcaatgcagatgctgggcaacacaaagatgaagacaaaaatatt
gctgaagaactccatcagaaggtcaaaatcctttgctgggtaatgacaggtcctcagaat
ctggaaaagaaggccaggcacgtcaaagcgacttgggcccagcgttgcaacaagatgctg
ttcatgagttctgaggaaaacaaagacttcccaacagtgggtttagaaaccaaagaaggc
agggaccagttgtattggaagaccattaaagctttccagtacgtccacgaccatcatctt
ggtgaagcagactggttcatgaaagcagacgatgacacgtatgttgcactggacaacttg
aggtggcttctttcgaagtacagtcctgaagaagcaatttattttggaagaaggtttaag
ccttatgtgaaacagggttacatgagtggcggtgcgggctatgtgctgagcaaagaagcc
ctgcggaggtttgtgaatgcttttaaaaccaacaaatgttctcatagctcttccatcgag
gacctggcactgggcaaatgcatggaggccattggtgtaaaagctggagattcccgggat
acaagtggcaaagaaacatttcatccctttgtgcctgaacatcatttaatcaaaggatac
ctacccaaaacgttttggtattggaattataactactatcctcctatagagggtcctgga
tgctgctctgacctggcagtttctttccactatgttgatgctgccactatgtatcagttg
gaatatttgatttatcatctccgcccctatggttatcaattcaggtacaatcctgacttt
cataagaatttaaaaacacaaaacttaagcgacacagcaaaagacgatgcagaagacaca
gcaaaagacgatgcagaaccaaaagtcgaaggtcctctgaagggctctaaataa

KEGG   Gekko japonicus: 107120730Help
Entry
107120730         CDS       T04299                                 

Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A-like
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
gja  Gekko japonicus
Pathway
gja00512  Mucin type O-glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107120730
   00514 Other types of O-glycan biosynthesis
    107120730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107120730
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     107120730
Glycosyltransferases [BR:gja01003]
 Glycan extension
  Type 3 chain
   107120730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 107120730
NCBI-ProteinID: XP_015278987
LinkDB All DBs
Position
Un
AA seq 363 aa AA seqDB search
MGFLTTKSSLLAFHLGLIAGFISTFYLVGNLRLEGPPRPGTQSPRSVRDSEWFVEKLALF
RVAHPHLAGEESSVSDDLYDKVRILCWVMTGPQNLETKARHVKATWSRHCNVVLFMSSVQ
DENFPTIGLGTKEGRDQLYWKTIRAFQYVHKHHFEQADWFLKADDDTFVVVDNLRWLLSN
YTPDTPIYFGKRFRPFAKQGYMSGGAGYILSKEALRRFVAGFDSKVCSHTTSVEDLALGQ
CMEKMGVVAGDSRDTEGRETFHPFVPESHLTEKFSKNFWYWNYCYYPIVEGPQCCSDLAI
SFHYVSSELMYTLEYLTYHLRAYGYRYRYHPPLPENTAHLQSHPQGVPLERTNTTTLQTE
MKM
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggggttcctgaccaccaagagctccctgttggctttccacctgggcctcatagctggc
tttatcagtaccttctacctcgtcggcaacctaaggttggaagggccaccccgtcccggc
actcagtcaccacgtagcgtcagggattctgagtggtttgtggagaaactggctctcttt
cgtgtggcacacccgcacctggcaggtgaggagagcagcgtgtctgatgatctgtatgat
aaagtacggatcctgtgctgggtgatgactggcccccaaaacttggagacaaaggcccgc
catgtgaaggccacctggtcccgccactgcaatgtggtccttttcatgagctcagtccaa
gatgagaactttcccactataggtctgggaaccaaggaaggccgggaccagctgtactgg
aaaaccatccgcgctttccagtacgtccacaagcaccattttgagcaggcagactggttc
ctcaaggcggacgacgacacctttgtggtggtggacaatctgcggtggctgctttccaac
tacactcctgacacacccatctattttggcaagcgcttccgtccctttgccaagcaaggc
tacatgagcgggggcgccggctacatcctcagcaaagaggccctgcggcgctttgtggct
ggctttgactccaaggtgtgcagccacaccacttcggtggaggacctggctttgggccag
tgcatggagaagatgggagtggtggctggggactcccgtgacacagagggcagagagact
ttccatccttttgtgccagagtcccacctgactgagaagttctccaaaaatttttggtac
tggaactattgctattaccctattgtggagggccctcagtgctgttctgacctggccatc
tccttccactacgtgagctcggaactgatgtacaccctggaatatctgacctaccacctc
cgtgcctatggttaccggtaccgctaccatccgcctttgcctgagaatacagctcatctt
cagtcccacccacaaggcgtgcccctggagagaactaataccaccacattgcagaccgag
atgaaaatgtag

KEGG   Gekko japonicus: 107123730Help
Entry
107123730         CDS       T04299                                 

Definition
(RefSeq) C1GALT1-specific chaperone 1-like
  KO
K09653  C1GALT1-specific chaperone 1
Organism
gja  Gekko japonicus
Pathway
gja00512  Mucin type O-glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107123730
   00514 Other types of O-glycan biosynthesis
    107123730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107123730
Glycosyltransferases [BR:gja01003]
 Glycan extension
  Type 3 chain
   107123730
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 107123730
NCBI-ProteinID: XP_015282547
LinkDB All DBs
Position
Un
AA seq 316 aa AA seqDB search
MISESGAFVKGMMLGGVFCVLVTLLGHIKMDSSTKSHEHRHLQAPKKEDVLNLSEDERLG
LSHSIRVYCIILVKPKDLSYWAAVRETWSKHCDKAEFYSSEKVKVFHSIVLDTEDMWLMM
RKAYKFAYENYKDDYNWFFLAHPTTFAVIENLKYFLLKQDSSQPFYTGRTETSGDLQYVN
GDGGVVLSIESLRRLHKVFEDPDKCPEQGGVIWKLSADKQLAVCLKYTGVHAENAEDSEK
KDIFNTKSVGSLIKEAMSSHPQQVVEGCCSDMAITFSGLAPNHMHVMMYGVYRLRAYGHS
FNDALVFLPPPGSDND
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgaaagtggtgcgtttgtgaagggtatgatgctaggaggggtcttctgtgtc
ctggtcactcttcttggacacattaagatggacagtagcactaaatctcatgagcaccgc
caccttcaggctcccaaaaaggaggatgttttaaatctttctgaagatgaacgcctgggt
cttagccatagcatccgtgtctactgcatcatccttgtcaaacctaaagaccttagctac
tgggcagctgtgagagagacttggagcaaacactgtgacaaggcagaattctacagttct
gaaaaggtcaaagtctttcactccattgtgcttgacacagaggacatgtggctaatgatg
aggaaagcatataaatttgcctatgaaaattacaaggatgactacaactggttcttcctg
gcccatcccaccacgtttgccgtaatagaaaacctcaaatattttctcctgaaacaagac
tcatcccagccattttacaccggccgtacagagacatctggagacctgcagtatgtgaat
ggtgatggaggagtcgtcttaagtattgaatcattgaggcgacttcataaagtttttgag
gatccagacaagtgtccagaacaggggggcgtgatttggaaactgtctgcagataaacag
ttagctgtctgcttgaagtacactggggtgcacgctgaaaacgcagaagattctgaaaaa
aaggacatcttcaacactaagtcagttggttctctaattaaagaggcaatgtcaagtcac
ccccaacaggtggtagaagggtgttgttcagacatggccatcacgttcagtgggttggct
cctaaccatatgcacgtgatgatgtacggagtctacaggctccgagcatatggacacagt
tttaatgatgccttggttttcctacctcccccgggctctgataatgactga

KEGG   Gekko japonicus: 107125272Help
Entry
107125272         CDS       T04299                                 

Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A-like
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
gja  Gekko japonicus
Pathway
gja00512  Mucin type O-glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107125272
   00514 Other types of O-glycan biosynthesis
    107125272
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107125272
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     107125272
Glycosyltransferases [BR:gja01003]
 Glycan extension
  Type 3 chain
   107125272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 107125272
NCBI-ProteinID: XP_015284202
LinkDB All DBs
Position
Un
AA seq 202 aa AA seqDB search
MTGPQNLETKARHVKATWSRHCNVVLFMSSVQDENFPTIGLGTKEGRDQLYWKTIRAFQY
VHKHHFEQADWFLKADDDTFVVVDNLRWLISNYTPDTPIYFGKRFRPFAKQGYMSGGAGY
ILSKEALRRFVAGFDSKVCSHTTSVEDLALGQCMEKMGVVAGDSRDTEGRETFHPFVPES
HLTEKFSKNFWYWNYCYYPIVE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgactggcccccaaaacttggagacaaaggcccgccatgtgaaggccacctggtcccgc
cactgcaatgtggtccttttcatgagctcagtccaagatgagaactttcccactataggt
ctgggaaccaaggaaggccgggaccagctgtactggaaaaccatccgcgctttccagtac
gtccacaagcaccattttgagcaggcagactggttcctcaaggcggacgacgacaccttt
gtggtggtggacaatctgcggtggctgatttccaactacactcctgacacacccatctat
tttggcaagcgcttccgtccctttgccaagcaaggctacatgagcgggggcgccggctac
atcctcagcaaagaggccctgcggcgctttgtggctggctttgactccaaggtgtgcagc
cacaccacttcggtggaggacctggctttgggccagtgcatggagaagatgggagtggtg
gctggggactcccgtgacacagagggcagagagactttccatccttttgtgccagagtcc
cacctgactgagaagttctccaaaaatttttggtactggaactattgctattaccctatt
gtggag

DBGET integrated database retrieval system