KEGG   Gekko japonicus: 107110419Help
Entry
107110419         CDS       T04299                                 

Definition
(RefSeq) actin-85C-like
  KO
K05692  actin beta/gamma 1
Organism
gja  Gekko japonicus
Pathway
gja04145  Phagosome
gja04210  Apoptosis
gja04510  Focal adhesion
gja04520  Adherens junction
gja04530  Tight junction
gja04810  Regulation of actin cytoskeleton
gja05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107110419
  09143 Cell growth and death
   04210 Apoptosis
    107110419
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107110419
   04520 Adherens junction
    107110419
   04530 Tight junction
    107110419
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107110419
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107110419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gja03021]
    107110419
   03019 Messenger RNA biogenesis [BR:gja03019]
    107110419
   03036 Chromosome and associated proteins [BR:gja03036]
    107110419
   03029 Mitochondrial biogenesis [BR:gja03029]
    107110419
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gja04812]
    107110419
   04147 Exosome [BR:gja04147]
    107110419
Transcription machinery [BR:gja03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107110419
Messenger RNA biogenesis [BR:gja03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107110419
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     107110419
    NuA4 complex
     107110419
  Chromatin remodeling factors
   BAF complex
    107110419
   PBAF complex
    107110419
   SWR1 complex
    107110419
Mitochondrial biogenesis [BR:gja03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    107110419
Cytoskeleton proteins [BR:gja04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107110419
Exosome [BR:gja04147]
 Exosomal proteins
  Proteins found in most exosomes
   107110419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin Actin_micro
Motif
Other DBs
NCBI-GeneID: 107110419
NCBI-ProteinID: XP_015266691
LinkDB All DBs
Position
Un
AA seq 372 aa AA seqDB search
MSHCRVPDLPAVIIDNGSGMCKAGLSGEQEPRSIVATVIGYPKSKSIMFGPAQREYYVGE
EAQAKRGILSFKYPVEHGMVTSWDDMEKIWRHIYRRELRMRARDRPVLLTEAPLNPAPNR
EKMTEIMFERFRVPAMFVGLQALLALYASARTTGLVLDSGDGVTMTVPVYKGHCLLHGIS
RMNFAGRDITRYLATLLLESGHIFSSSAEKEIVKNIKETMCYVALDPSQEKGSAHKYVLP
DGNSVKIGDQLHRTPESLFSPTDAGVSSPGIHEMILNSISNCNGSIQQNIWSNVFMAGGS
TLFTGLSDRLLKELQALAPRGMPVKVTAPEDRVYSVWIGASVLTSLASFRNMWVTQQEYN
EVGPTVLQKKCF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctcactgcagagtaccagaccttccagctgtcattattgacaatggatcagggatg
tgtaaagctggattgtctggagagcaggaaccacgaagcattgtagctactgtgattggc
tatccaaagtctaaatccattatgtttgggcctgctcagagggaatattacgttggggaa
gaagctcaagccaagaggggcattttatcttttaaataccctgtggaacatggcatggtg
acatcctgggatgatatggagaagatctggaggcacatatacaggcgggagctcaggatg
agggccagagacagacccgtgctgctgacggaggccccgctcaaccctgcaccaaaccga
gaaaaaatgacagaaatcatgtttgagcgtttccgggtgcctgccatgtttgtgggcctg
caagctctgttggctctctatgcctcggctcgaaccacgggcttagtcctagatagtggg
gatggtgtcaccatgacagtccccgtctataaaggccattgtttgcttcacggcatttcg
aggatgaattttgcaggccgggatatcaccagatatttagcaacacttctcttggagagc
gggcatatcttttcaagttcggctgagaaggagatagtgaagaacatcaaggagaccatg
tgctatgttgctttggaccctagccaggagaaagggtcagcccataaatacgttctccca
gatgggaattctgtcaagattggtgaccagcttcacagaactccagagtccctttttagc
cccactgatgcaggcgtctcatcaccagggatccacgagatgatcttgaacagtatttcg
aactgcaatgggagcatccagcaaaacatctggagcaatgtgttcatggcaggggggtcc
accctctttactggtctaagcgacagacttcttaaggagctccaggctctggcacccagg
ggcatgccggtaaaagtcacagcaccagaagatagggtgtattctgtctggattggtgct
tcggtactcaccagtttggcttcctttaggaacatgtgggtgacccagcaagagtacaat
gaagtcggtccaaccgtgttgcagaaaaaatgcttctga

DBGET integrated database retrieval system