KEGG   Gekko japonicus: 107110554Help
Entry
107110554         CDS       T04299                                 

Gene name
ST6GAL1
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
gja  Gekko japonicus
Pathway
gja00510  N-Glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Module
gja_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107110554 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    107110554 (ST6GAL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107110554 (ST6GAL1)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     107110554 (ST6GAL1)
Glycosyltransferases [BR:gja01003]
 Terminal extension
  Sialyltransferase
   107110554 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 107110554
NCBI-ProteinID: XP_015266841
LinkDB All DBs
Position
Un
AA seq 421 aa AA seqDB search
MVHVNLVKKWMYVLLAFLVVLTICLWKETRKGYYVSLKEESPSEQVHITLWKGSIPKQQN
VHHQSINISNKVLLSTKASEVKVKENISVRQAGSNLVTNPKKPAGSIKVWNKDSSSKNLT
PRLQKARKNYLAMNKYRVNYSGIKNAAKLSPEKLLCQLRERLNFQMIEASDGPFNTSEWE
AYLPRRNISMELGQLGQCAVVSSAGSMKFSRLGPEIDNHEAVLRFNGAPTRGFQADVGGK
TTIRLINSQLLTVEEQKVITDPQYNTGTLIVWDPAPYHADIHEWYRKPDYNFFSSYKKYR
NRQPEQPFYILNPYMQWQLWDILQENSPEDIQPNPPSSGMLGIVIMMHLCDKVDVYEFLP
SKRQTDICHYFQKFFDQACTMGAYHPLLFEKNMVKHLNQGTDEDIYTHGKVTLNGLRNVQ
C
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggttcatgttaacttggttaaaaaatggatgtatgtcctccttgcatttcttgtagtt
ctgactatttgtctgtggaaggaaacacgaaaaggttattatgtttctttaaaagaagaa
agcccatctgagcaagtgcacataacactatggaaagggagcattccaaaacaacaaaat
gtccatcatcaatctatcaacatttctaacaaggtgcttttgtcaaccaaagcatccgaa
gtcaaagttaaagaaaatatttctgtaaggcaagcaggaagtaacttagtaacaaacccc
aaaaagccagcaggttccataaaagtgtggaacaaggacagttcatccaaaaatctcacc
cctagactgcaaaaggcgaggaaaaactacctggctatgaacaaatatcgtgtgaattac
agtggaataaaaaatgctgctaaactcagccctgagaaactgctgtgccagctccgggaa
cgattgaattttcagatgatagaggcatcagatggtcctttcaatacatctgaatgggaa
gcctacctgccaaggagaaacatcagcatggaactgggccagctgggccaatgtgcagta
gtgtcctcagcaggatccatgaagttttcccgcttgggaccagaaatagacaaccacgag
gcagtgttgcgttttaatggggctcctaccagagggtttcaggctgatgtaggggggaaa
acaacaatacgtctgattaattcccagcttcttactgttgaagaacaaaaggttattacg
gatccgcaatataacactggaacattaattgtgtgggatccagcaccatatcatgcagat
atccatgagtggtacagaaaaccagattacaatttctttagcagctacaaaaagtatcga
aacagacaacctgagcaacctttttacatcctgaatccctatatgcagtggcaactttgg
gatatccttcaagaaaattcaccagaggatatccagccaaatccaccctcttcaggaatg
cttggtattgttatcatgatgcacttgtgtgacaaagtggatgtttacgagtttcttcct
tccaaaaggcaaacagacatttgtcattatttccagaagttctttgaccaagcctgcacc
atgggtgcctaccacccactgctcttcgagaagaatatggtgaagcaccttaaccaaggc
acagatgaagacatttacacgcatggaaaagtgactcttaatggcttgaggaatgtacag
tgttag

KEGG   Gekko japonicus: 107115211Help
Entry
107115211         CDS       T04299                                 

Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 1-like
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
gja  Gekko japonicus
Pathway
gja00510  N-Glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Module
gja_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107115211
   00514 Other types of O-glycan biosynthesis
    107115211
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107115211
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     107115211
Glycosyltransferases [BR:gja01003]
 Terminal extension
  Sialyltransferase
   107115211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 107115211
NCBI-ProteinID: XP_015272336
LinkDB All DBs
Position
Un
AA seq 424 aa AA seqDB search
MVYLICLQLGLVLHLGPRGGRGLSISMGTVFRGIQSPDAGNRTLELLPAESGSRNFGSVP
RAPSWGSFLSSGRSFWQRLVEVLIGSRHHRRASQSSLSAQPLPWPVWQKELSSQVLDPRL
QQVFRNYQAMNKYHVPPDVGMRQGVPRLTGMELLCHLKARVDVRTLVEDEGPFAAPEWTG
VLPQRSLAEDMGPLERCAVVSSAGSMLGSGLGKEIDSHDAVLRFNGAPTMGYERDVGTKT
SLRLVNSQLMASPEQHFLDGLLYTQGVLVAWDPAPYPGDLQEWYEAPDYPLFGPFRTVRS
RRPWQLFHLLHPRLQWQLWELVQEGASEQVQRNPPSSGLLGTVLMMSLCDIIHLYEFLPS
RRQTHQCHYYQTFSDDACTLGAYHPLLFEKELVRRMNQGSQEDLAQRGRVTLPGFRALNC
TEGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtctacttgatctgcctgcagttggggctcgtgctgcatttggggccacgtgggggc
cggggcctctccatttccatgggaacagtcttccggggcatccaatcccctgatgcggga
aacaggactctggagctcctccccgctgagtctggcagccggaactttggctctgtgcca
cgggctccatcttggggttctttcctctccagcggcaggagcttctggcaacgtctcgtg
gaggtgctcattgggtcgcggcatcaccggagggcttcccagtccagcctctctgcccag
cccctgccctggcctgtctggcaaaaggagctctcgtctcaggtgctggacccccgtctc
cagcaggtcttccgaaactaccaggccatgaacaagtaccacgtgcccccagatgttggg
atgcgccaaggagtcccacgcttgactgggatggagctcttgtgccacctcaaagcccgt
gtggatgtgaggaccctggtggaggatgagggcccctttgcggcccctgagtggactgga
gtgctgccccagaggagcctggccgaggacatggggcctctggagaggtgtgcggtagtg
agttccgccggctccatgttgggatctggactgggcaaggagattgactcccatgatgct
gttcttcgcttcaatggagcgccgaccatgggctacgaacgtgacgtgggcacaaaaacc
agcctccgccttgtgaactcccagctgatggcctcccctgagcagcattttctggatggc
ctcctctacacccagggagtcttagtggcttgggacccagctccttacccaggagacctg
caggagtggtacgaggcccccgattaccccctctttggcccattccgcaccgtgcgctcc
cgcagaccttggcagctctttcacctcttgcacccacggttgcagtggcagctctgggaa
ctggtgcaggaaggagcaagcgaacaggtgcagaggaatcctccttcctcggggctgctt
gggacggtgctcatgatgtccctttgtgacatcatccacctatacgagttcctgccatcg
cgacgccagactcaccaatgccactattaccagaccttctcggacgacgcctgcacactt
ggtgcctatcacccattgctttttgagaaggaactggtgcggcgcatgaaccagggctcc
caggaagacctagcacaacgtggtcgtgtgacactgcctgggttccgtgccctgaactgt
acggagggtgagtaa

KEGG   Gekko japonicus: 107120284Help
Entry
107120284         CDS       T04299                                 

Gene name
ST3GAL3
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
gja  Gekko japonicus
Pathway
gja00513  Various types of N-glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja00515  Mannose type O-glycan biosynthesis
gja00533  Glycosaminoglycan biosynthesis - keratan sulfate
gja00601  Glycosphingolipid biosynthesis - lacto and neolacto series
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    107120284 (ST3GAL3)
   00515 Mannose type O-glycan biosynthesis
    107120284 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    107120284 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    107120284 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107120284 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107120284 (ST3GAL3)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     107120284 (ST3GAL3)
Glycosyltransferases [BR:gja01003]
 Terminal extension
  Sialyltransferase
   107120284 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 107120284
NCBI-ProteinID: XP_015278438
LinkDB All DBs
Position
Un
AA seq 418 aa AA seqDB search
MKMGLLVFMRNLLLALCLFLVLGFLYYSAWKLHLLRWEDSNSVVLSSDSVGHSIGSGRRE
GKSTSLVPLSSLPSHLAAELGTGKAQKEPVAVPHPVTPKYDKLGFLLKLDSKLPPELASK
YANISEGVCKPGYASALMTAIFPKFSRPAPMFLDDSFRKWARIRDFVPPFGVKGQDNLIK
AILSVTKDYRLTPALDSLSCRRCIIVGNGGILANKSLGLKIDDYDIVIRLNSAPVKGFEK
DVGGKTTLRITYPEGAIQKPEQYEKDSLFVLAGFKWQDFKWLKYIVYKEKVSASDGFWKS
VATQVPREPHEIRILNPYFIQEAAFSFIGLPFNNGLMGRGNIPTLGSVAITMVLHNCDEV
AVAGFGYDMNSPNAPLHYYENIKMSAIKESWTHNIQREKEFLRKLVKARVITDLTSGI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggactactggtgttcatgcgtaacctgctacttgccctctgtctctttctg
gtgttgggctttctctattactcagcttggaaactgcatcttctccgatgggaggattca
aattcagtggttctttcctctgactccgttggacattcaataggctcaggaaggagagag
ggaaaatccacatctcttgtgcctctgtcatctctcccatcacaccttgctgccgagttg
ggaacaggcaaagctcagaaagaacctgtggctgttccacacccagtcactcctaaatat
gacaaactgggctttcttctgaagttggactccaaattgcctccagagctagcatcaaag
tatgctaacatctcagaaggagtttgcaagcctggatatgcatctgctctcatgactgcc
atctttccaaagttctccaggccagcacctatgttcttggatgattccttcagaaagtgg
gcacgtattcgggacttcgtgcctccctttggagtcaaaggacaagataatctgatcaaa
gccatcctgtcagtaaccaaagattaccgtcttactccagcccttgacagtctcagttgc
cggcgatgtattattgtgggaaatggtggcattctagcaaacaaatctttggggttgaaa
attgatgactatgacattgttatcaggctgaactctgctccagtaaaaggttttgaaaag
gatgtgggtggcaagacaaccctgcggataacatatccagaaggggccatccagaaaccg
gaacaatatgaaaaggattctctctttgtgctagcagggttcaaatggcaagatttcaag
tggctgaagtacattgtttacaaggagaaagtgagtgcctcagatgggttttggaagtct
gtggctacccaagttccaagagagcctcatgagatccgtatcctgaacccatatttcatc
caggaggcagctttcagctttattggccttcctttcaacaatggactgatgggcagaggg
aacattcctactttgggaagtgtagcaataaccatggtactccacaattgtgatgaagta
gcagtggctggatttggttatgatatgaactctccaaacgcaccattgcattactatgag
aacatcaagatgtctgctatcaaagagtcctggacgcacaacatccagcgggagaaggag
ttcctgcgaaagttggtgaaagctcgagtcatcacagacctcaccagcggaatctga

KEGG   Gekko japonicus: 107125130Help
Entry
107125130         CDS       T04299                                 

Gene name
ST6GAL2
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
gja  Gekko japonicus
Pathway
gja00510  N-Glycan biosynthesis
gja00514  Other types of O-glycan biosynthesis
gja01100  Metabolic pathways
Module
gja_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107125130 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    107125130 (ST6GAL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gja01003]
    107125130 (ST6GAL2)
Enzymes [BR:gja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     107125130 (ST6GAL2)
Glycosyltransferases [BR:gja01003]
 Terminal extension
  Sialyltransferase
   107125130 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 107125130
NCBI-ProteinID: XP_015284075
LinkDB All DBs
Position
Un
AA seq 529 aa AA seqDB search
MKPNLKQWKQLMLFGIFAWGLLFLVIFIYFTDSNTAEAVPSSFSYIETKRLLPIQGKQRV
IMGAIHDPSFSEPIDGNEVLLNKDILDSFKSGNGNIKKWTDLEEGFESEEEFFPSQLKRK
SKRAFYQRDADYLFAAGQPRPQSRVQRIVRLISAEGEGQKGNSLQNNWLPQKKMKRRHTR
RRRSQMFEESDEWDGIYSTMSKSFLYKLWKGNVSSKMLNPRLQKAMKDYLNTNKHGVRFK
GKRNSKLTSEQLFCELKARVNIRTIDGKEAPFSVLGWEKHVPQMSLSKLYPRGFGTCAVV
MSAGAILNSSLGDEIDSHDAVLRFNSAPTRGYEKDVGNKTTMRIINSQILTNPNHHFIES
SLYKDVILVAWDPAPYSANLNVWFKKPDYNLFTPYVQHRRKNPNQPFYILHPKFIWQLWD
IIQENTKEKIQPNPPSSGFIGILIMMSMCSEVHVYEYIPSVRQTDLCHYHELYYDAACTL
GAYHPLLYEKLLVQRMNKGLQDDLYRKGKVILPGFRSVKCPGQNRFPYT
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctaacttgaaacaatggaaacaactaatgctatttggaatatttgcatggggc
ctgctgttcctggtgattttcatctatttcacagacagcaacaccgctgaagcagttcca
agttccttctcttacatcgagacgaagaggcttctgcccattcaaggcaagcagagagtt
attatgggagcaatacatgacccgtctttctctgaaccaatcgatgggaacgaggtgctt
cttaacaaagatatcttggattcatttaaatcagggaacggaaacattaaaaagtggacg
gacttagaagaaggctttgaaagcgaagaagaatttttcccttcccagttaaaaagaaaa
tcaaaaagggctttctatcagagggatgctgattatttgtttgctgctggtcagcctcgg
ccacagagtcgtgttcagcgaatagtgagattaatctctgcagagggggagggtcagaag
gggaactctttgcagaacaactggctccctcaaaagaagatgaagagaaggcacacaaga
cgcaggagaagccaaatgtttgaagagtctgatgaatgggatggaatatattccacaatg
tcaaaatctttcctgtataagctttggaaagggaacgtctcttccaagatgttgaatcct
cgcctgcagaaagcaatgaaagactacctgaataccaataagcacggggtgcgattcaaa
gggaagcgaaactccaagttgacctccgaacagctcttctgtgagctcaaggcaagagtg
aacatcaggaccatagatggcaaagaagcccctttttctgtgcttggctgggaaaaacac
gtcccccagatgtcgctgagtaaattgtatccacgtgggtttgggacctgtgctgtcgtt
atgtccgccggtgccatactgaactcctccctaggtgacgaaatagattcccatgatgca
gttctccgatttaattctgctcccacacgaggctatgaaaaagatgttggaaataaaact
accatgcgtatcattaattctcagattctcactaaccctaaccatcacttcattgagagc
tccttatataaagatgtcatcttagtagcttgggatcctgctccctattctgctaatttg
aatgtgtggtttaagaagccagactacaatttgtttactccctacgttcagcatcgcagg
aagaatccaaaccagccattttacattctccatccaaagttcatatggcagctctgggac
attattcaggagaacaccaaggagaagattcagcccaaccctccttcttcaggtttcatt
ggaatcctcatcatgatgtcaatgtgcagtgaagtgcacgtatacgaatacattccttca
gtccgacagactgacctttgccactaccatgaactgtactatgatgcagcttgtaccttg
ggggcttaccatccactgctctacgagaaactgttggtgcagaggatgaacaaaggatta
caggacgatctgtaccgaaaaggaaaagtgattttgccagggttcaggtcagtgaaatgc
cctggacaaaaccgattcccctacacttaa

DBGET integrated database retrieval system