KEGG   Gekko japonicus: 107110762Help
Entry
107110762         CDS       T04299                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gja  Gekko japonicus
Pathway
gja00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107110762 (GPD2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107110762 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_6 FAD_binding_2 EF-hand_1 GIDA FAD_oxidored EF-hand_8 Pyr_redox_2 EF-hand_9 NAD_binding_8 FAD_binding_3 HI0933_like Pyr_redox_3 Thi4 EF-hand_5 Dockerin_1 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 107110762
NCBI-ProteinID: XP_015267052
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFRKAVKGSILIGGGAVATVFGLSQLSQYRKKHGHLASVEASECKTLQMQSHLPTRESQ
LQGLQNTSEFDVLVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMRLDFEQYRMVKEALHERANLLEIAPNLSAPLPIMLPVYRWWQLPYYWVGIKLY
DLVAGSQCLKSSYVLSKSKALELFPMLRKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYTEVVCLLKKTDPKSGKVRVCGARCRDVLTGQEFDVKAKCVINATGPFTDSVRKM
DEQEVANICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWQKMTIAGTTDTATE
VTHHPIPTEEDINFILTEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSISRNH
VVHVSDSGLVTIAGGKWTTYRSMAQDAIDAAVNAHNLHADSCKTVGLFLQGANGWSPTLY
IRLVQDYGLENEVAQHLAATYGDKAFEVAKLAQVTGKRWPIVGKRLVSEFPYIESEVEYA
IQEYACTAVDIIARRTRLAFLNVQAAEEALPRIIEIMGKKLKWSEHKKKEELAEAKKFLY
YEMGYKVRSEQLTDHGEITLTPMDIERYKKRFHMFDKAGKGFITILDVQRVLESINLQIN
ECALHEILNEVDLNKNGQVELNEFLQLMNAIQKGYVSGSRLAVLMKTAEENIHQRNVISV
DRSGGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgcaaggcagtgaaaggatctatccttattggaggaggcgctgtggcaact
gtgtttggtctttcacaactttctcagtataggaaaaaacatggtcatcttgcatctgtt
gaagcttcagaatgtaagaccctgcaaatgcaaagccaccttcctaccagagaaagtcag
ctccagggtctgcagaacaccagtgaatttgacgttcttgtaataggtggaggcgccaca
ggatgtggctgtgccttggatgctgttacgagaggcctaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggcggagtgaga
tatcttcagaaggccatcatgaggttggattttgaacagtacagaatggtgaaagaagcc
ctccatgaacgtgccaatttgctggagattgcccctaatttatctgctcctctccctata
atgcttcctgtttacagatggtggcagctgccatactattgggtaggaattaaactctat
gacctcgtagcaggaagccagtgtctaaaaagcagctatgtgcttagcaaatcaaaggcc
ttggaactctttcctatgttgcggaaggacaaacttgtaggtgccattgtctactatgat
ggacaacacaacgatgcacgaatgaaccttgccattgctctcactgctgccaggtatggt
gctgccacagccaattacactgaagtggtgtgcttgctgaagaagacagatccaaagagc
gggaaggtccgtgtctgtggagcaaggtgcagggatgttctcacagggcaggaatttgat
gtcaaagccaaatgtgttatcaatgctacaggacctttcacagactctgtgcggaaaatg
gatgagcaggaagtagcaaacatctgtcagccaagtgcaggcgttcatattgtgatgcct
gggtattacagccctgataatatgggacttcttgacccagcgaccagcgatggacgagtt
attttcttcttgccatggcagaagatgaccattgctggcaccacagatactgccactgaa
gtcacacatcacccaattcctacagaagaagatatcaacttcatcttgacagaagtgcgc
aactatcttagctgtgatgttgaagtgaggagaggtgatgttcttgcagcatggagtggt
attcgccctcttgtgacagatcccaattctaaagacacccagtccatatctcggaatcat
gtagtccatgttagtgacagcggccttgtgactatagcaggagggaaatggacaacctat
cgctcaatggctcaggatgccattgatgctgctgtaaatgcccataaccttcatgcagat
tcatgtaagacagttggactctttctccagggtgcaaatggctggagtcctaccctttat
attcgactggttcaggactacggacttgaaaatgaggtggctcagcatcttgcagctacg
tatggagacaaggcttttgaagtggccaagttagcccaggttactgggaagaggtggccg
attgttggaaaacggctcgtatcagagtttccttacattgagtctgaggttgagtatgca
atccaggaatatgcctgcactgcagtggatatcattgctcgtcgcacacgcttagccttc
ctgaatgtccaagctgctgaggaagccttaccaagaatcattgagatcatggggaagaag
ctcaaatggagcgagcataagaaaaaggaagagcttgcagaagcgaagaagttcctgtac
tatgaaatgggctacaaggtacggtcagagcaattgacggatcatggtgaaatcactctg
acaccaatggatattgagagatataaaaagaggttccacatgtttgataaggctggcaaa
ggttttattactatattggacgtacagcgtgtgttagagagcatcaaccttcagattaat
gaatgtgcactccatgaaattttgaatgaggtggatttgaacaaaaatgggcaggttgaa
ctcaatgagtttttgcagctcatgaatgctattcagaaaggatatgtctctggcagccga
cttgctgtacttatgaaaacggctgaagagaacattcatcagcgtaatgtgatttcagtg
gatcggagtggcggtggactgtga

DBGET integrated database retrieval system